close all open/close all
A4793_00330 A4793_00330   last last

CDS information : A4793_00340


close this sectionLocation

Organism
StrainNRRL 15009
Entry nameA47934
Contig
Start / Stop / Direction67,715 / 69,301 / + [in whole cluster]
67,715 / 69,301 / + [in contig]
Location67715..69301 [in whole cluster]
67715..69301 [in contig]
TypeCDS
Length1,587 bp (528 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)unknown
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in A47934 biosynthesis.
Note (GenBank)
  • ORF1; similar to Corynebacterium glutamicum hypothetical 69.1 kDa protein: Swiss-Prot Accession Number P54122

close this sectionSequence

selected fasta
>[unknown]
MTVFEHAGKLLIVDCGVLFPEETQPGVDVILPDFTSIRDRLDDVVAVVLTHGHEDHIGGV
PYLLRERRDIPVVGSKLTLAFLEAKLKEHGIRPRTVRVREGDRRGLGPFDCEFVAVNHSI
PDSLAVAIRTRAGMVLHTGDFKMDQFPLDDRITDLRAFARLGEEGVDLFLTDSTNAEVPG
FTTSERELNPAIEQVMRTAPRRVIVSSFASHVHRIQQVLDAAHQHGRKVAFVGRSMVRNM
GIARDLGYLKVPSGLVVSTKELEKLPDHKITLVCTGSQGEPMAALSRMANRDHMIRIGKG
DTVLLASSLIPGNENAIYRVINGLTRWGAHVVHKGNAKVHVSGHASAGELVYCYNIVKPR
NVMPVHGEWRHLRANGDLAIRTGVDPERVVIAEDSVIVDLVDGRASITGKVPAGNVYVDG
MEVGGATEASLKDRLTLAAEGVVTVVAIVDADTGALAEAPDFLARGFVHDDATFEPVVPV
IEKTLATAAEEGVGDAHQLEQLIARAVANWAFRTYRRKPLIIPVIIDA
selected fasta
>[unknown]
ATGACAGTCTTCGAGCACGCCGGCAAACTGCTGATCGTCGACTGCGGCGTGCTGTTCCCC
GAGGAGACCCAGCCCGGCGTGGACGTGATCCTGCCGGACTTCACCTCGATCCGGGACCGG
CTGGACGACGTCGTGGCCGTGGTCCTCACCCACGGTCACGAGGACCACATCGGCGGCGTG
CCGTATCTGCTGCGCGAGCGCAGGGACATCCCGGTGGTCGGCTCCAAGCTGACCCTGGCG
TTCCTGGAGGCCAAGCTCAAGGAGCACGGCATCCGGCCGCGCACGGTGCGGGTACGGGAG
GGTGACCGGCGCGGTCTTGGTCCCTTCGACTGCGAGTTCGTGGCGGTCAACCACTCCATC
CCGGACAGCCTCGCGGTCGCGATCCGCACCCGCGCCGGGATGGTGCTGCACACCGGCGAC
TTCAAGATGGACCAGTTCCCCCTCGACGACCGCATCACCGATCTGCGCGCCTTCGCCCGC
CTCGGCGAGGAGGGCGTGGACCTGTTCCTCACCGACTCCACCAACGCCGAGGTACCCGGC
TTCACCACCTCCGAGCGGGAGCTGAACCCGGCGATCGAGCAGGTGATGCGCACCGCGCCG
CGCCGGGTCATCGTCTCCAGCTTCGCCAGCCACGTTCACCGCATCCAGCAGGTCCTGGAC
GCCGCCCACCAGCACGGCCGCAAGGTCGCCTTCGTCGGCCGGTCGATGGTCCGCAACATG
GGCATTGCCCGTGACCTGGGCTATCTGAAGGTCCCTTCCGGTCTGGTCGTGAGCACGAAG
GAGCTGGAGAAGCTCCCGGACCACAAGATCACTCTGGTGTGCACCGGCTCGCAGGGCGAA
CCGATGGCCGCGCTGTCGCGGATGGCCAACCGGGACCACATGATCCGCATCGGCAAGGGC
GACACCGTCCTGCTGGCCAGCTCCCTCATCCCCGGCAACGAGAACGCCATCTACCGGGTG
ATCAACGGGCTGACCCGGTGGGGCGCCCACGTGGTCCACAAGGGCAACGCCAAGGTGCAC
GTGTCCGGACACGCCAGCGCCGGCGAGCTCGTGTACTGCTACAACATCGTCAAGCCCCGC
AACGTCATGCCGGTGCACGGCGAGTGGCGGCATCTGCGGGCCAACGGCGACCTCGCCATC
CGCACCGGCGTCGACCCGGAGCGGGTCGTCATCGCCGAGGACAGCGTCATCGTCGACCTC
GTCGACGGGCGCGCGTCCATCACGGGCAAGGTTCCCGCCGGCAACGTCTACGTCGACGGG
ATGGAGGTCGGCGGCGCCACGGAGGCGTCCCTCAAGGACCGTCTCACCCTGGCCGCCGAA
GGCGTGGTCACGGTGGTGGCCATCGTCGACGCGGACACCGGTGCCCTCGCAGAGGCCCCC
GACTTCCTGGCCCGCGGCTTCGTCCACGACGACGCCACGTTCGAGCCGGTCGTCCCCGTC
ATCGAGAAGACCCTGGCCACCGCGGCCGAGGAAGGCGTCGGGGACGCCCACCAGCTCGAA
CAGCTCATCGCCCGCGCCGTGGCGAACTGGGCGTTCCGCACGTACCGCCGCAAGCCCCTC
ATCATCCCCGTCATCATCGACGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001279 Beta-lactamase-like (Domain)
 [1-153]  2.2e-23 PF00753
PF00753   Lactamase_B
 [1-192]  5.29999657550189e-24 SM00849
SM00849   Lactamase_B
IPR004613 Ribonuclease J (Family)
 [1-528]  PIRSF004803
PIRSF004803   RnjA
IPR011108 RNA-metabolising metallo-beta-lactamase (Domain)
 [337-370]  3.4e-09 PF07521
PF07521   RMMBL
SignalP No significant hit
TMHMM No significant hit
A4793_00330 A4793_00330   last last