close all open/close all
first first   Acla_00020 Acla_00020

CDS information : Acla_00010


close this sectionLocation

Organism
StrainATCC 31615
Entry nameAclacinomycin A
Contig
Start / Stop / Direction617 / 3 / - [in whole cluster]
617 / 3 / - [in contig]
Locationcomplement(3..617) [in whole cluster]
complement(3..617) [in contig]
TypeCDS
Length615 bp (204 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-4 ketoreductase(fragment)
Product (GenBank)AknM
Gene
Gene (GenBank)aknM
EC number
Keyword
  • L-rhodosamine
  • L-2-deoxyfucose
Note
Note (GenBank)
  • dTDP-4-keto-6-deoxyhexose reductase homolog
Reference
ACC
PmId
[12137949] Cloning and characterization of Streptomyces galilaeus aclacinomycins polyketide synthase (PKS) cluster. (Gene. , 2002)
[12427929] Characterization of mutations in aclacinomycin A-non-producing Streptomyces galilaeus strains with altered glycosylation patterns. (Microbiology. , 2002)
Related Reference
ACC
O33708
NITE
Adria_00200
PmId
[9209071] Cloning and characterization of the Streptomyces peucetius dnmZUV genes encoding three enzymes required for biosynthesis of the daunorubicin precursor thymidine diphospho-L-daunosamine. (J Bacteriol. , 1997)
[10631513] A two-plasmid system for the glycosylation of polyketide antibiotics: bioconversion of epsilon-rhodomycinone to rhodomycin D. (Chem Biol. , 1999)
[9447597] Production of the antitumor drug epirubicin (4'-epidoxorubicin) and its precursor by a genetically engineered strain of Streptomyces peucetius. (Nat Biotechnol. , 1998)

close this sectionSequence

selected fasta
>putative NDP-hexose C-4 ketoreductase(fragment) [AknM]
MLGATGCVGRCVSAALAREGHEVLAVARRGGPAVADYLFAGLDVAAVPPAELARLLTGHR
VRAVVNVTGGWGTTEEEMRYAHITLVDRLLRALTLMDDRPRLVHVGSIHEYGPVPEPLSI
GEDLPPRPATMYARTKLAGSELVLDAASTGRVDALVLRAVNVCGPRTTRASFLGAVAGML
RAADAANPVTLRVADARRDFVDVRD
selected fasta
>putative NDP-hexose C-4 ketoreductase(fragment) [AknM]
GTGCTCGGGGCCACCGGCTGTGTCGGACGCTGTGTGAGTGCCGCTCTGGCGCGCGAGGGG
CACGAGGTGCTCGCCGTGGCCCGGCGCGGCGGGCCCGCGGTGGCGGATTACCTCTTCGCC
GGCCTGGACGTGGCGGCGGTCCCCCCTGCCGAGCTGGCGCGGCTGCTCACCGGGCACCGG
GTGCGCGCCGTGGTCAACGTGACGGGCGGCTGGGGCACGACCGAGGAGGAGATGCGGTAC
GCGCACATCACCCTGGTCGACCGGCTGCTGCGGGCCCTGACACTGATGGACGACCGGCCG
CGCCTGGTCCATGTGGGTTCCATCCACGAGTACGGGCCGGTGCCCGAGCCCCTCTCCATC
GGCGAGGATCTTCCACCCCGGCCGGCGACGATGTACGCCAGGACCAAGCTGGCCGGCTCC
GAGCTGGTGCTCGACGCGGCCAGCACCGGCCGGGTGGACGCCCTGGTGCTGCGCGCGGTG
AACGTGTGCGGTCCCCGCACCACCCGGGCCAGTTTCCTCGGGGCGGTCGCCGGCATGCTG
CGGGCCGCCGACGCGGCGAACCCGGTGACGCTGCGTGTCGCGGACGCGCGGCGGGACTTC
GTCGATGTGCGTGAT

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [2-205]  3.3e-29 PF01370
PF01370   Epimerase
IPR016040 NAD(P)-binding domain (Domain)
 [3-205]  2.5e-24 G3DSA:3.40.50.720
G3DSA:3.40.50.720   no description
SignalP
 [1-17]  0.26 Signal
Bacteria, Gram-negative   
TMHMM No significant hit
first first   Acla_00020 Acla_00020