close all open/close all

CDS information : Acla_00020


close this sectionLocation

Organism
StrainATCC 31615
Entry nameAclacinomycin A
Contig
Start / Stop / Direction1,261 / 656 / - [in whole cluster]
1,261 / 656 / - [in contig]
Locationcomplement(656..1261) [in whole cluster]
complement(656..1261) [in contig]
TypeCDS
Length606 bp (201 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose epimerase
Product (GenBank)AknL
Gene
Gene (GenBank)aknL
EC number5.1.3.-
Keyword
  • L-rhodosamine
  • L-2-deoxyfucose
  • L-rhodinose
Note
Note (GenBank)
  • dTDP-4-keto-6-deoxyhexose 3,5-epimerase
Reference
ACC
PmId
[12137949] Cloning and characterization of Streptomyces galilaeus aclacinomycins polyketide synthase (PKS) cluster. (Gene. , 2002)
Related Reference
ACC
Q9S0P2
NITE
Aver_00150
PmId
[11451669] Insights about the biosynthesis of the avermectin deoxysugar L-oleandrose through heterologous expression of Streptomyces avermitilis deoxysugar genes in Streptomyces lividans. (Chem Biol. , 2001)

close this sectionSequence

selected fasta
>putative NDP-hexose epimerase [AknL]
MQFRELAVSGAFVFTPPVFEDDRGLFTSPFQEPAFVAALGHPLFPVAQSNHSRSRRGTVR
GIHYTVTPPGVAKYVYCARGRAIDIVVDIRVGSPTYGRWDSSVLDPEGFRAMYFPVGVGH
AFVALEDDTVMSYMLSGSYEAQHEMSLSPLDPALGLPIPQDVAPLLSARDTAAPLLEQVR
AEGGLPEYDKCRRIEAALWRP
selected fasta
>putative NDP-hexose epimerase [AknL]
GTGCAGTTCCGCGAACTCGCCGTCTCCGGCGCGTTCGTCTTCACTCCGCCCGTCTTCGAG
GACGACCGCGGTCTGTTCACCTCGCCGTTCCAGGAACCTGCCTTCGTGGCGGCACTGGGC
CACCCCCTGTTCCCGGTCGCGCAGTCCAACCACAGCAGGTCGCGGCGCGGCACCGTACGG
GGCATCCACTACACGGTCACCCCGCCGGGCGTGGCGAAGTACGTGTACTGCGCCCGGGGC
CGCGCCATCGACATCGTGGTCGACATCCGCGTCGGCTCGCCCACCTACGGCCGCTGGGAC
TCCTCGGTGCTCGACCCGGAGGGGTTTCGCGCCATGTACTTCCCGGTCGGCGTCGGGCAC
GCCTTCGTCGCCCTGGAGGACGACACGGTGATGTCGTACATGCTCTCGGGAAGCTACGAG
GCGCAGCACGAGATGTCCCTCTCCCCGCTCGACCCCGCGCTCGGCCTGCCGATCCCCCAG
GACGTGGCACCCCTGCTGTCCGCGCGGGACACGGCCGCGCCCCTGCTCGAGCAGGTGCGG
GCGGAGGGCGGCCTGCCGGAGTACGACAAGTGCCGTCGGATCGAGGCCGCACTGTGGCGG
CCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000888 dTDP-4-dehydrorhamnose 3,5-epimerase-related (Family)
 [1-183]  PD001462
PD001462   dTDP_sugar_isom
 [4-178]  1.2e-55 PF00908
PF00908   dTDP_sugar_isom
IPR011051 RmlC-like cupin domain (Domain)
 [1-183]  2.2999842048857e-66 SSF51182
SSF51182   RmlC_like_cupin
IPR014710 RmlC-like jelly roll fold (Domain)
 [1-191]  4.39999999999997e-58 G3DSA:2.60.120.10
G3DSA:2.60.120.10   RmlC-like_jellyroll
SignalP
 [1-20]  0.606 Signal
Bacteria, Gram-negative   
TMHMM No significant hit