close all open/close all

CDS information : Acla_00030


close this sectionLocation

Organism
StrainATCC 31615
Entry nameAclacinomycin A
Contig
Start / Stop / Direction2,596 / 1,274 / - [in whole cluster]
2,596 / 1,274 / - [in contig]
Locationcomplement(1274..2596) [in whole cluster]
complement(1274..2596) [in contig]
TypeCDS
Length1,323 bp (440 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductL-2-deoxyfucose glycosyltransferase
Product (GenBank)AknK
Gene
Gene (GenBank)aknK
EC number
Keyword
Note
Note (GenBank)
  • glycosyl transferase
Reference
ACC
PmId
[12137949] Cloning and characterization of Streptomyces galilaeus aclacinomycins polyketide synthase (PKS) cluster. (Gene. , 2002)
[15078101] AknK is an L-2-deoxyfucosyltransferase in the biosynthesis of the anthracycline aclacinomycin A. (Biochemistry. , 2004)
[17685523] Characterization of rhodosaminyl transfer by the AknS/AknT glycosylation complex and its use in reconstituting the biosynthetic pathway of aclacinomycin A. (J Am Chem Soc. , 2007)

close this sectionSequence

selected fasta
>L-2-deoxyfucose glycosyltransferase [AknK]
MKVLFTTFAAKSHMHAQVPLAWALQTAGHEVRIASQPDLAEDITRTGLTAVCVGEPLLLE
EQMQRVNEGLGDDAEIMESQAEAGMDMTETRPEMLTWDHVLGVFTSMTAMAFQNSCPERM
IDDVVAFAREWQPDLIVWDTLSFAGPVAAQVTGAAHARLLFGLDLLGRMRETFLDLQEER
LPEQRDDPLREWLTWTLGRYGAEFEEEVAVGQWTVDPVPPSMRFPVKQPFVPLRYIPYNG
QAVIPDWLHEPPKKRRVCLTLGVAHREVLDGDRASIGELVEALAELDVEVVATLNEKQLA
GMELPDNVRAVDFVPLNALLPTCSAVIHHGGSGTFQTALAHGVPQLIVPDMVWDTIHKAK
QLERFGAGLYLHDVDNYTAQDLRDHLLRLLEEPSFAENCARIRREMVGTPSPNDIVPLLE
KLTAEHRRDRGARGTVRGEQ
selected fasta
>L-2-deoxyfucose glycosyltransferase [AknK]
ATGAAGGTCCTGTTCACCACGTTCGCCGCGAAGTCCCATATGCATGCCCAGGTTCCGCTG
GCCTGGGCCCTCCAGACCGCGGGCCACGAGGTCCGTATCGCCAGCCAGCCGGACCTGGCG
GAGGACATCACCCGTACCGGACTGACCGCCGTGTGTGTCGGTGAGCCGCTGCTCCTGGAG
GAGCAGATGCAGCGGGTCAACGAGGGCCTGGGCGACGACGCCGAGATCATGGAGAGCCAG
GCGGAAGCCGGGATGGACATGACGGAGACCCGTCCCGAGATGCTGACCTGGGACCACGTC
CTCGGTGTGTTCACCTCGATGACGGCGATGGCCTTCCAGAACTCCTGCCCTGAGCGCATG
ATCGACGACGTGGTCGCGTTCGCCCGCGAGTGGCAGCCCGACCTGATCGTCTGGGACACG
CTGTCCTTCGCGGGGCCGGTGGCCGCGCAGGTCACCGGCGCCGCCCACGCCCGGCTGCTG
TTCGGCCTCGATCTGCTGGGGCGGATGCGGGAGACCTTCCTCGACCTTCAGGAGGAGCGG
CTGCCCGAGCAGCGGGACGACCCGCTGCGCGAGTGGCTGACCTGGACGCTCGGCCGCTAC
GGCGCCGAGTTCGAGGAGGAGGTGGCGGTCGGTCAGTGGACCGTCGACCCGGTGCCGCCG
TCGATGCGGTTCCCGGTGAAGCAGCCGTTCGTGCCACTGCGGTACATCCCCTACAACGGG
CAGGCCGTCATCCCGGACTGGCTGCACGAGCCGCCGAAGAAGCGCCGCGTCTGTCTGACG
CTGGGGGTGGCCCACCGCGAGGTGCTGGACGGCGACCGCGCCTCGATCGGCGAACTCGTC
GAGGCGCTCGCGGAACTGGACGTCGAGGTGGTCGCGACGCTCAACGAGAAGCAGCTCGCC
GGGATGGAACTGCCGGACAACGTCAGGGCCGTCGACTTCGTCCCGCTCAACGCGCTGCTG
CCGACCTGCTCCGCGGTCATCCACCACGGTGGCTCCGGCACCTTCCAGACGGCGCTGGCG
CATGGTGTCCCGCAGCTCATCGTGCCCGACATGGTCTGGGACACGATCCACAAGGCGAAG
CAGCTCGAGCGGTTCGGGGCGGGGCTCTACCTGCACGACGTCGACAACTACACCGCTCAG
GACCTGCGCGACCACCTGCTGCGGCTGCTGGAGGAGCCGTCGTTCGCAGAGAACTGCGCG
CGTATCCGCCGGGAGATGGTGGGCACGCCGAGCCCCAACGACATCGTCCCGCTGCTGGAG
AAGCTCACCGCGGAACACCGCCGTGACCGAGGTGCCCGTGGCACCGTCCGAGGGGAGCAG
TAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [3-134]  7.20000000000001e-11 PF03033
PF03033   Glyco_transf_28
IPR010610 Domain of unknown function DUF1205 (Domain)
 [215-309]  1.99999999999999e-33 PF06722
PF06722   DUF1205
SignalP
 [1-23]  0.783 Signal
Eukaryota   
TMHMM No significant hit