close all open/close all

CDS information : Acla_00040


close this sectionLocation

Organism
StrainATCC 31615
Entry nameAclacinomycin A
Contig
Start / Stop / Direction4,034 / 2,682 / - [in whole cluster]
4,034 / 2,682 / - [in contig]
Locationcomplement(2682..4034) [in whole cluster]
complement(2682..4034) [in contig]
TypeCDS
Length1,353 bp (450 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative cyclase/dehydratase
Product (GenBank)AknE1
Gene
Gene (GenBank)aknE1
EC number
Keyword
  • 1st ring
Note
Note (GenBank)
  • putative bifunctional aromatase
Reference
ACC
PmId
[12137949] Cloning and characterization of Streptomyces galilaeus aclacinomycins polyketide synthase (PKS) cluster. (Gene. , 2002)
Related Reference
ACC
Q54811
NITE
Adria_00240
PmId
[9224566] Iterative type II polyketide synthases, cyclases and ketoreductases exhibit context-dependent behavior in the biosynthesis of linear and angular decapolyketides. (Chem Biol. , 1997)

close this sectionSequence

selected fasta
>putative cyclase/dehydratase [AknE1]
MAHEVHTTEHTITVAAAPEAVFGLVERAEDWPHVFPPSLHVEYLERSGEEERLRIWATAN
GEVKSWTSRRTLDRAGLRIRFRQEVSQDPVAAMGGEWIVEALPGGGSRVRLLHDFRAVDD
LERNVSWILEAIERNSGAELAALESAALRTGTDEAPYTFEDSVRIDAPAQDVRDFLHDAG
QWQERLPHVARVLLKEDTPDVQHLEMDTRTPDGSTHTTASVRICLPDGRITYKQLQTPAL
MSVHTGEWSVREIPSGCVAVSRHTVVVNAAAVTKVLGASATTADARTFIRDALGGNSTIT
MRHAKEYAQRRAATEPVPPAEYASVQRFYARQMRLLDEGEGDAWADTFTEDGTFDQSSFA
EPLRGRAAIAAAVRGRPAAPAGTVRRHWLGLPAAWRFPDGSVRTAYDALVVSTEAGAAPV
IRLSTSCQDVLVADGDGWLVSHRYVGHDGQ
selected fasta
>putative cyclase/dehydratase [AknE1]
ATGGCGCACGAGGTGCACACGACCGAACACACGATCACCGTGGCCGCCGCCCCGGAGGCC
GTCTTCGGCCTGGTGGAGCGGGCGGAGGACTGGCCGCACGTCTTTCCGCCGAGCCTGCAC
GTGGAGTATCTGGAGCGGTCGGGCGAGGAGGAGCGGCTGCGCATCTGGGCCACCGCCAAC
GGCGAGGTCAAGTCCTGGACCTCACGGCGCACCCTGGACCGCGCGGGACTGCGGATCCGG
TTCCGCCAGGAGGTCTCCCAGGATCCCGTAGCCGCGATGGGCGGGGAGTGGATCGTCGAG
GCGCTCCCCGGCGGCGGCAGCCGGGTCCGGCTGCTGCACGACTTCCGGGCCGTCGACGAC
CTGGAACGCAACGTCAGCTGGATCCTGGAGGCGATCGAGCGCAACAGCGGGGCCGAGCTG
GCCGCGCTGGAGTCCGCCGCGCTGCGCACCGGCACCGACGAGGCGCCCTACACCTTCGAG
GACTCGGTGCGCATCGACGCCCCGGCCCAGGACGTGCGGGACTTCCTGCACGACGCGGGG
CAGTGGCAGGAACGGCTGCCGCACGTCGCCCGGGTGCTGCTGAAGGAGGACACGCCCGAC
GTCCAGCACCTGGAGATGGACACCCGCACCCCCGACGGTTCGACGCACACCACGGCTTCG
GTGCGGATCTGCCTGCCCGACGGGCGGATCACGTACAAGCAGCTGCAGACGCCGGCCCTG
ATGTCCGTGCACACCGGGGAGTGGTCGGTACGGGAGATCCCGTCCGGCTGCGTGGCCGTC
TCCCGGCACACCGTGGTCGTCAACGCGGCGGCCGTCACCAAGGTCCTCGGTGCCTCCGCG
ACGACCGCCGACGCCCGCACCTTCATCCGGGACGCGCTCGGCGGCAACAGCACGATCACC
ATGCGGCACGCCAAGGAGTACGCGCAGCGGCGGGCCGCGACGGAGCCGGTGCCGCCGGCC
GAGTACGCCTCGGTCCAGCGGTTCTACGCCCGTCAGATGCGGCTCCTCGACGAGGGCGAG
GGGGATGCCTGGGCGGACACCTTCACCGAGGACGGGACCTTCGACCAGAGCTCGTTCGCC
GAGCCGCTGCGCGGCCGGGCGGCGATCGCGGCGGCGGTGCGCGGCCGGCCCGCGGCGCCC
GCCGGCACGGTGCGCCGGCACTGGCTGGGCCTGCCGGCCGCCTGGCGGTTCCCGGACGGT
TCGGTGCGCACGGCCTACGACGCCCTGGTCGTCTCGACCGAGGCGGGCGCCGCTCCGGTG
ATCCGGCTGAGCACCTCGTGCCAGGACGTCCTCGTCGCCGACGGGGACGGCTGGCTGGTG
AGCCACCGCTACGTCGGCCACGACGGGCAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR019587 Polyketide cyclase/dehydrase (Family)
 [6-146]  1e-10 PF10604 [158-303]  1.1e-07 PF10604
PF10604   Polyketide_cyc2
IPR023393 START-like domain (Domain)
 [7-116]  2.80000000000001e-14 G3DSA:3.30.530.20 [158-291]  3.90000000000001e-11 G3DSA:3.30.530.20
G3DSA:3.30.530.20   G3DSA:3.30.530.20
SignalP
 [1-23]  0.077 Signal
Eukaryota   
TMHMM No significant hit