close all open/close all

CDS information : Acla_00060


close this sectionLocation

Organism
StrainATCC 31615
Entry nameAclacinomycin A
Contig
Start / Stop / Direction5,079 / 5,447 / + [in whole cluster]
5,079 / 5,447 / + [in contig]
Location5079..5447 [in whole cluster]
5079..5447 [in contig]
TypeCDS
Length369 bp (122 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative 12-deoxyaklanonic acid C-12 oxygenase
Product (GenBank)AknX
Gene
Gene (GenBank)aknX
EC number
Keyword
  • anthraquinone
Note
Note (GenBank)
  • polyketide oxygenase
Reference
ACC
PmId
[12137949] Cloning and characterization of Streptomyces galilaeus aclacinomycins polyketide synthase (PKS) cluster. (Gene. , 2002)
Related Reference
ACC
Q8VWB4
PmId
[12399480] Expression, purification, and characterization of AknX anthrone oxygenase, which is involved in aklavinone biosynthesis in Streptomyces galilaeus. (J Bacteriol. , 2002)

close this sectionSequence

selected fasta
>putative 12-deoxyaklanonic acid C-12 oxygenase [AknX]
MTDHEPGTEGADAVTFVNTFTVHAEPEVFEKEFARTSEFMAQQPGFVRHTLCRHAERPGQ
YVNVAEWRDLASFRAAVSHDGFRPHADALRALSESRPELYLVRLRREGAPGLDGPASEGE
EI
selected fasta
>putative 12-deoxyaklanonic acid C-12 oxygenase [AknX]
ATGACGGATCATGAGCCAGGCACCGAGGGGGCCGACGCCGTGACCTTCGTGAACACCTTC
ACCGTGCACGCCGAACCCGAGGTGTTCGAGAAGGAGTTCGCGCGGACGTCGGAGTTCATG
GCACAGCAGCCGGGTTTCGTCCGGCACACGCTCTGCCGGCACGCGGAGCGGCCCGGCCAG
TACGTCAACGTCGCCGAGTGGCGGGACCTCGCCTCGTTTCGCGCGGCCGTCTCGCACGAC
GGCTTCCGGCCGCACGCCGACGCGCTGCGCGCGCTGAGCGAGAGCCGGCCCGAACTGTAT
CTGGTACGGCTGCGCCGCGAGGGCGCCCCGGGTCTCGACGGTCCGGCGTCCGAAGGGGAG
GAGATATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007138 Antibiotic biosynthesis monooxygenase (Domain)
 [14-87]  9.29999999999998e-18 PF03992
PF03992   ABM
IPR011008 Dimeric alpha-beta barrel (Domain)
 [4-106]  1.79999754022375e-18 SSF54909
SSF54909   Dimer_A_B_barrel
SignalP
 [1-24]  0.036 Signal
Eukaryota   
 [1-24]  0.175 Signal
Bacteria, Gram-negative   
TMHMM No significant hit