close all open/close all

CDS information : Acla_00070


close this sectionLocation

Organism
StrainATCC 31615
Entry nameAclacinomycin A
Contig
Start / Stop / Direction5,444 / 6,715 / + [in whole cluster]
5,444 / 6,715 / + [in contig]
Location5444..6715 [in whole cluster]
5444..6715 [in contig]
TypeCDS
Length1,272 bp (423 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase beta-ketoacyl synthase subunit
Product (GenBank)AknB
Gene
Gene (GenBank)aknB
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
  • ketosynthase KSI; minimal PKS
Reference
ACC
PmId
[12137949] Cloning and characterization of Streptomyces galilaeus aclacinomycins polyketide synthase (PKS) cluster. (Gene. , 2002)
Related Reference
ACC
Q55223
NITE
Dauno_00160
PmId
[9098068] Minimal Streptomyces sp. strain C5 daunorubicin polyketide biosynthesis genes required for aklanonic acid biosynthesis. (J Bacteriol. , 1997)

close this sectionPKS/NRPS Module

KS4..375

close this sectionSequence

selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [AknB]
MTARRVVITGLGVIAPGGIGTKAFWERVVSGVSATRTITAFDASGFRSRMAAECDFDGVR
SGLTVRDTARLDRATQFAVVAAREALADSGIEIDERNAHRTGVSLGSAVGCTQKLEEEYV
ARSDGGQRWLVDHAAGTPYLYDYFVPSSMAAEVAWEAGAEGPAALVSAGCTSGLDSLGHA
LDLIREGTVDIMIAGGSDAPIAPITVACFDAIKATSPRNDTPEHASRPFDRTRSGFVLGE
GAAVLVLEERESALRRGAQIYAEIAGYAGRGNAHHMTGLRPDGLEMSAAITGALDDARID
REAVGYVNAHGTATRQNDIHETAAIKHSLGEHAHRVPVSSIKAVIGHSLGAVGSIEAVAS
ALVIRHGVVPPTAGLHEPDPQLDLDYVPLTARDQATDTVLTVGSGFGGFQSAMVLTSAEG
SRS
selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [AknB]
ATGACGGCCCGCCGGGTGGTGATCACCGGCCTGGGAGTGATCGCCCCGGGTGGCATCGGC
ACCAAGGCGTTCTGGGAACGCGTCGTCTCCGGCGTCTCCGCGACCAGGACCATCACGGCC
TTCGACGCGTCCGGGTTCCGCTCCCGGATGGCCGCGGAGTGCGACTTCGACGGCGTCCGC
TCGGGCCTGACCGTCCGTGACACCGCACGGCTGGACCGTGCCACCCAGTTCGCGGTGGTC
GCCGCGCGCGAGGCGCTCGCCGACAGCGGCATCGAGATCGACGAGAGGAACGCCCACCGC
ACCGGGGTCAGCCTCGGCTCCGCCGTGGGGTGCACCCAGAAGCTCGAGGAGGAGTACGTC
GCGCGCAGTGACGGCGGGCAGCGGTGGCTGGTCGATCACGCCGCCGGCACACCGTACCTG
TACGACTACTTCGTGCCGAGTTCGATGGCGGCCGAAGTGGCGTGGGAGGCCGGCGCCGAG
GGCCCCGCCGCGCTCGTCTCGGCGGGCTGCACCTCCGGTCTCGACTCCCTCGGGCACGCG
CTCGACCTCATCAGGGAGGGCACCGTCGACATCATGATCGCCGGTGGCAGCGACGCGCCC
ATCGCACCCATCACCGTGGCCTGTTTCGACGCCATCAAGGCGACCTCGCCGCGCAACGAC
ACCCCGGAGCACGCCTCGCGGCCCTTCGACAGGACCCGCAGCGGCTTCGTGCTCGGCGAG
GGTGCGGCCGTACTCGTCCTGGAGGAGCGGGAGTCCGCCCTGCGGCGCGGAGCACAGATC
TACGCCGAGATCGCGGGCTACGCCGGGCGTGGCAACGCCCACCACATGACCGGACTGCGC
CCCGACGGACTGGAGATGTCCGCCGCCATCACCGGCGCCCTCGACGACGCCCGCATCGAC
CGCGAAGCCGTCGGTTACGTCAACGCGCACGGTACGGCCACCCGGCAGAACGACATCCAC
GAGACGGCCGCGATCAAGCACAGCCTGGGCGAGCACGCCCACCGGGTCCCGGTCAGCTCC
ATCAAGGCGGTCATCGGTCACTCGCTCGGCGCCGTCGGCTCCATCGAGGCCGTCGCCTCC
GCCCTGGTGATCCGGCACGGAGTGGTGCCGCCCACGGCGGGACTGCACGAGCCCGATCCC
CAGCTCGACCTCGACTACGTTCCGCTGACCGCGCGCGATCAGGCCACCGACACCGTGCTG
ACGGTGGGCAGCGGATTCGGCGGATTCCAGAGCGCCATGGTGCTCACCAGCGCCGAAGGG
AGCCGCTCATGA
KS4..375
KS10..1125

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [4-252]  2.59999999999998e-58 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [261-375]  3.89999999999997e-33 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [2-266]  4.10000000000004e-64 G3DSA:3.40.47.10 [272-418]  1.09999999999999e-48 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [3-258]  2.89997807423187e-66 SSF53901 [220-419]  4.50001022902825e-61 SSF53901
SSF53901   Thiolase-like
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [161-177]  PS00606
PS00606   B_KETOACYL_SYNTHASE
SignalP
 [1-20]  0.862 Signal
Eukaryota   
TMHMM No significant hit