close all open/close all

CDS information : Acla_00080


close this sectionLocation

Organism
StrainATCC 31615
Entry nameAclacinomycin A
Contig
Start / Stop / Direction6,712 / 7,935 / + [in whole cluster]
6,712 / 7,935 / + [in contig]
Location6712..7935 [in whole cluster]
6712..7935 [in contig]
TypeCDS
Length1,224 bp (407 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase chain length factor subunit
Product (GenBank)AknC
Gene
Gene (GenBank)aknC
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
  • KS II; minimal PKS; chain length determinant
Reference
ACC
PmId
[12137949] Cloning and characterization of Streptomyces galilaeus aclacinomycins polyketide synthase (PKS) cluster. (Gene. , 2002)
Related Reference
ACC
Q54174
NITE
Urd_00130
PmId
[7592377] Cloning and characterization of a polyketide synthase gene from Streptomyces fradiae Tu2717, which carries the genes for biosynthesis of the angucycline antibiotic urdamycin A and a gene probably involved in its oxygenation. (J Bacteriol. , 1995)

close this sectionPKS/NRPS Module

CLF6..362

close this sectionSequence

selected fasta
>polyketide synthase chain length factor subunit [AknC]
MSAATVVTGIGVLAPNGIGAEEFWAATLRAESGIGRITRFEPASYPSRLAGEVTGFSARD
HIPSRLVPQTDRTTQFALTGSEWALRDSGLSADSLPADERGVVTASASGGFEFGQRELGH
LWGKDPRHVSAYMSFAWFYAVNSGQISIRHDLRGPTGVLVTDQAGGLDAVAQARRRIRKG
TPVMLSGGMDASLCPYGLAAQISAGMLSESDDPARAYRPFDPAADGHVPGEGGAILTLED
GERARARGARSHGEISGYAATFDPRPGSGRPANLDRAIRGALADAGLTPRDIAFVLADGA
GEPEPDRAEARALTDVFGPRGVPVTVPKSMTGRLYAGAVPLDLVTALFALRDGVVPPTVH
VDGPDPAYDIDLVTGSAGPSAETRALVLARGRGGFNSAMVVRRPSAA
selected fasta
>polyketide synthase chain length factor subunit [AknC]
ATGAGTGCCGCGACCGTGGTCACCGGAATCGGTGTGCTCGCGCCCAACGGGATCGGGGCG
GAGGAGTTCTGGGCGGCCACCCTGCGCGCCGAGAGCGGCATCGGCCGCATCACCCGCTTC
GAGCCCGCCTCGTATCCCTCCCGGCTGGCCGGCGAGGTCACGGGGTTCTCGGCACGGGAC
CACATACCGAGCCGGCTCGTCCCGCAGACCGACCGCACCACGCAGTTCGCCCTGACGGGC
TCCGAGTGGGCACTGCGGGACTCCGGACTGTCCGCCGACAGCCTGCCGGCGGACGAGCGC
GGGGTGGTCACCGCCAGCGCCTCCGGCGGGTTCGAGTTCGGCCAGCGCGAACTGGGCCAT
CTGTGGGGCAAGGACCCCCGGCACGTCAGCGCGTACATGTCCTTCGCCTGGTTCTACGCC
GTCAACTCCGGTCAGATCTCCATCCGGCACGATCTGCGAGGCCCCACCGGAGTGCTCGTC
ACCGACCAGGCGGGCGGTCTCGACGCGGTGGCACAGGCCAGGCGCCGGATCCGCAAGGGC
ACCCCGGTCATGCTGTCCGGCGGCATGGACGCCTCGCTGTGCCCCTACGGGCTCGCGGCC
CAGATCTCCGCCGGAATGCTCAGCGAGAGCGACGACCCGGCCCGCGCCTACCGGCCGTTC
GACCCGGCGGCCGACGGCCATGTGCCGGGCGAGGGCGGGGCGATCCTGACCCTGGAGGAC
GGGGAACGGGCGCGGGCGCGCGGGGCACGCAGCCACGGGGAGATCAGCGGGTACGCCGCC
ACCTTCGACCCCCGTCCCGGCTCGGGCCGGCCCGCCAACCTGGACCGGGCGATCCGGGGC
GCGCTGGCCGACGCCGGGCTGACCCCGCGGGACATCGCCTTCGTCCTCGCGGACGGCGCC
GGTGAACCGGAACCCGACCGGGCCGAGGCGCGGGCGCTCACCGACGTCTTCGGCCCCCGG
GGCGTACCCGTGACGGTCCCCAAGAGCATGACGGGGCGCCTCTACGCGGGTGCCGTCCCG
CTCGATCTCGTCACCGCCCTGTTCGCACTGCGCGACGGCGTCGTCCCGCCGACGGTCCAC
GTCGACGGACCGGACCCCGCCTACGACATCGACCTCGTGACCGGCTCCGCCGGCCCGTCC
GCGGAGACGCGGGCGCTGGTCCTGGCCCGGGGACGCGGCGGCTTCAACAGCGCCATGGTC
GTACGGCGCCCGTCGGCGGCCTGA
CLF6..362
CLF16..1086

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [6-239]  7.69999999999997e-52 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [253-362]  1.1e-25 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [5-257]  2.19999999999997e-57 G3DSA:3.40.47.10 [270-404]  1.2e-37 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [2-249]  4.19999771339582e-59 SSF53901 [212-404]  6.29998179434732e-49 SSF53901
SSF53901   Thiolase-like
SignalP
 [1-20]  0.156 Signal
Bacteria, Gram-negative   
 [1-20]  0.884 Signal
Eukaryota   
 [1-20]  0.223 Signal
Bacteria, Gram-positive   
TMHMM No significant hit