close all open/close all

CDS information : Acla_00090


close this sectionLocation

Organism
StrainATCC 31615
Entry nameAclacinomycin A
Contig
Start / Stop / Direction8,039 / 8,314 / + [in whole cluster]
8,039 / 8,314 / + [in contig]
Location8039..8314 [in whole cluster]
8039..8314 [in contig]
TypeCDS
Length276 bp (91 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase acyl carrier protein subunit
Product (GenBank)AknD
Gene
Gene (GenBank)aknD
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
  • acyl carrier protein
Reference
ACC
PmId
[12137949] Cloning and characterization of Streptomyces galilaeus aclacinomycins polyketide synthase (PKS) cluster. (Gene. , 2002)
Related Reference
ACC
Q9ZAU0
NITE
Adria_00040
PmId
[7828855] Characterization of the Streptomyces peucetius ATCC 29050 genes encoding doxorubicin polyketide synthase. (Gene. , 1994)
ACC
P12885
NITE
Grana_00280
PmId
[8468280] Genetic construction and functional analysis of hybrid polyketide synthases containing heterologous acyl carrier proteins. (J Bacteriol. , 1993)
[9305965] Utilization of enzymatically phosphopantetheinylated acyl carrier proteins and acetyl-acyl carrier proteins by the actinorhodin polyketide synthase. (Biochemistry. , 1997)

close this sectionPKS/NRPS Module

ACP5..77

close this sectionSequence

selected fasta
>polyketide synthase acyl carrier protein subunit [AknD]
MSAFTVEELFQIMRECAGEEEAVDLADAAEQEFSLLGYDSLALMEAISRVERGLGIDLPE
ETVGEVLTPAAFVDVVNAELARSAPVVEAAG
selected fasta
>polyketide synthase acyl carrier protein subunit [AknD]
ATGTCCGCTTTCACGGTAGAAGAGCTTTTCCAGATCATGCGCGAGTGCGCGGGCGAGGAG
GAGGCCGTCGATCTGGCCGACGCCGCGGAGCAGGAGTTCTCCCTGCTCGGCTACGACTCC
CTCGCGCTCATGGAGGCGATCAGCAGGGTGGAGCGGGGTCTCGGCATCGACCTGCCCGAG
GAGACGGTGGGCGAGGTGCTGACGCCCGCCGCGTTCGTCGACGTCGTCAACGCCGAACTG
GCCCGCAGCGCGCCCGTGGTGGAGGCCGCCGGATGA
ACP5..77
ACP13..231

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006162 Phosphopantetheine attachment site (PTM)
 [35-50]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1-85]  2.2999993566538e-12 SSF47336
SSF47336   ACP_like
 [5-81]  6.40000000000001e-13 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [5-77]  PS50075
PS50075   ACP_DOMAIN
 [25-75]  6.59999999999999e-07 PF00550
PF00550   PP-binding
SignalP
 [1-28]  0.059 Signal
Bacteria, Gram-positive   
TMHMM No significant hit