close all open/close all

CDS information : Acla_00100


close this sectionLocation

Organism
StrainATCC 31615
Entry nameAclacinomycin A
Contig
Start / Stop / Direction8,311 / 9,417 / + [in whole cluster]
8,311 / 9,417 / + [in contig]
Location8311..9417 [in whole cluster]
8311..9417 [in contig]
TypeCDS
Length1,107 bp (368 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase beta-ketoacyl synthase subunit
Product (GenBank)AknE2
Gene
Gene (GenBank)aknE2
EC number
Keyword
  • propionyl-CoA dependent
  • type II PKS
Note
Note (GenBank)
  • similar to DpsC
Reference
ACC
PmId
[12137949] Cloning and characterization of Streptomyces galilaeus aclacinomycins polyketide synthase (PKS) cluster. (Gene. , 2002)
Related Reference
ACC
Q54816
NITE
Adria_00290
PmId
[10419974] The Streptomyces peucetius dpsC gene determines the choice of starter unit in biosynthesis of the daunorubicin polyketide. (J Bacteriol. , 1999)
[10423255] Purification and properties of the Streptomyces peucetius DpsC beta-ketoacyl:acyl carrier protein synthase III that specifies the propionate-starter unit for type II polyketide biosynthesis. (Biochemistry. , 1999)
ACC
Q55225
NITE
Dauno_00180
PmId
[11162232] The product of dpsC confers starter unit fidelity upon the daunorubicin polyketide synthase of Streptomyces sp. strain C5. (Metab Eng. , 2001)

close this sectionPKS/NRPS Module

KS122..352

close this sectionSequence

selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [AknE2]
MTEEHLDPAGGAPTARAPEQDIRIAGCAAWLPPRVPVAKTVAAGLCDEALATATAMVSVA
VAQDEPAPEMAARAARTALARDGSDDVSLILHASFFYQGHDLWAPASYVQRVAVGNRCPA
IEVGQVSNGGMAALGLAVDHLSAGRPAEAGRRVLVTTGDAFRPPGFDRWRSDPGTFYGDG
GTALVLSSGEGFARIRGLATVSAPELEGMHRGDDPFGDTPFSHRPVVDLEACKKDFLASR
RVTQVIAASAAAQDAALGQALAAAGAGLADIDRFVLPHMGRKRLRAGFLNRLGIGEDRTT
WEWSRGVGHLGAGDQIAGFDHLVGSGSLGPGDLVLWMSVGAGFTYSCAVVEMLERPGWAG
TARTAGAA
selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [AknE2]
ATGACCGAGGAGCACCTCGACCCCGCGGGCGGCGCTCCCACCGCGCGGGCCCCGGAGCAG
GACATCCGGATCGCGGGGTGCGCAGCCTGGCTGCCGCCCCGCGTGCCGGTCGCGAAGACG
GTGGCTGCGGGACTGTGCGACGAGGCCCTGGCCACGGCCACCGCCATGGTCTCGGTGGCC
GTGGCGCAGGACGAGCCGGCCCCCGAGATGGCGGCGAGGGCGGCCCGGACCGCCCTCGCG
CGCGACGGCTCCGACGACGTGTCGCTGATCCTGCACGCCAGCTTCTTCTACCAGGGGCAC
GACCTGTGGGCGCCCGCCTCCTACGTCCAGCGCGTCGCCGTCGGCAACCGGTGCCCCGCG
ATCGAGGTCGGCCAGGTGTCCAACGGCGGCATGGCCGCCCTCGGCCTCGCCGTCGACCAC
CTGAGCGCCGGGCGGCCGGCCGAGGCGGGCCGGCGCGTCCTGGTGACGACCGGTGACGCC
TTCCGCCCGCCCGGCTTCGACCGCTGGCGCAGCGATCCGGGCACCTTCTACGGGGACGGG
GGCACCGCGCTGGTGCTGTCCTCGGGGGAGGGGTTCGCCCGGATCCGCGGACTGGCCACC
GTCTCCGCTCCGGAGCTGGAGGGGATGCACCGCGGTGACGACCCCTTCGGGGACACACCG
TTCAGCCACCGTCCGGTCGTCGACCTGGAAGCCTGCAAGAAGGACTTCCTCGCCTCTCGC
CGGGTGACCCAGGTGATCGCCGCGAGCGCGGCCGCGCAGGACGCAGCCCTCGGCCAGGCC
CTCGCGGCGGCCGGGGCCGGACTCGCGGACATCGACCGCTTCGTCCTTCCCCACATGGGC
CGCAAGCGGTTGCGGGCCGGCTTCCTCAACCGCCTCGGGATCGGGGAGGACCGCACCACC
TGGGAGTGGAGCCGCGGTGTCGGGCACCTGGGGGCCGGTGACCAGATCGCCGGCTTCGAC
CACCTGGTCGGCTCCGGGAGCCTCGGCCCCGGCGACCTGGTCCTGTGGATGAGCGTGGGC
GCCGGGTTCACCTACTCCTGCGCGGTCGTCGAGATGCTGGAACGGCCCGGCTGGGCCGGT
ACGGCGCGTACGGCAGGTGCCGCGTGA
KS122..352
KS364..1056

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013747 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C-terminal (Domain)
 [261-352]  5.20000000000001e-20 PF08541
PF08541   ACP_syn_III_C
IPR013751 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III (Domain)
 [122-195]  1.1e-05 PF08545
PF08545   ACP_syn_III
IPR016038 Thiolase-like, subgroup (Domain)
 [19-182]  5.69999999999999e-16 G3DSA:3.40.47.10 [183-191]  3.2e-20 G3DSA:3.40.47.10 [224-351]  3.2e-20 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [12-355]  2.90000354677981e-25 SSF53901
SSF53901   Thiolase-like
SignalP
 [1-38]  0.13 Signal
Bacteria, Gram-negative   
TMHMM No significant hit