close all open/close all

CDS information : Acla_00110


close this sectionLocation

Organism
StrainATCC 31615
Entry nameAclacinomycin A
Contig
Start / Stop / Direction9,414 / 10,457 / + [in whole cluster]
9,414 / 10,457 / + [in contig]
Location9414..10457 [in whole cluster]
9414..10457 [in contig]
TypeCDS
Length1,044 bp (347 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative acyl-ACP thioesterase
Product (GenBank)AknF
Gene
Gene (GenBank)aknF
EC number
Keyword
  • type II thioesterase
  • non-acetate starter unit
Note
Note (GenBank)
  • similar to DpsD
Reference
ACC
PmId
[12137949] Cloning and characterization of Streptomyces galilaeus aclacinomycins polyketide synthase (PKS) cluster. (Gene. , 2002)
Related Reference
ACC
Q9KHK3
NITE
Enter_00120
PmId
[21531566] Policing starter unit selection of the enterocin type II polyketide synthase by the type II thioesterase EncL. (Bioorg Med Chem. , 2011)
ACC
Q9F6D9
NITE
R1128_00030
PmId
[15260498] The acyltransferase homologue from the initiation module of the R1128 polyketide synthase is an acyl-ACP thioesterase that edits acetyl primer units. (Biochemistry. , 2004)

close this sectionSequence

selected fasta
>putative acyl-ACP thioesterase [AknF]
MTGTAGALPVALLLPGQGSQHRRMAAGLYGHEPVFTEAMDEFFDAAGPEGDPLRDDWLAE
RPVTDIDHVTRSQPLLFAVDHALGRLVLGRGVRPAALLGHSIGELAAATLAGVFAPRDAA
GLVLDRIRRLSAAPPGGMLAVAASTAEVAPYLRGDVVVGAVNAPRQTVLAGPDGPLDEVD
RALREAGFVCRRVPSLSAFHSPVLEPACRGAAPLFAAACKHPPAVPVHSAYTAAPLTESD
IDDPAFWARQPVAPVLFWPALEGLLATGDHLLVEVGPGQGLSQLVRRHPAVRRGGSAVVS
LLPARPGPPEADRAAVAAATEQITAAGRQAAPASADHGRPSRQAAAG
selected fasta
>putative acyl-ACP thioesterase [AknF]
GTGACCGGCACCGCGGGGGCCCTGCCGGTCGCCCTGCTGCTGCCGGGCCAGGGCTCCCAG
CACCGGCGGATGGCCGCGGGGCTCTACGGGCACGAGCCGGTGTTCACCGAGGCCATGGAC
GAGTTCTTCGACGCGGCCGGCCCCGAGGGCGATCCGCTGCGCGACGACTGGCTGGCCGAA
CGGCCCGTCACGGACATCGACCACGTCACCCGCTCACAGCCGCTGCTCTTCGCCGTGGAC
CACGCGCTGGGGCGGCTGGTGCTCGGCCGGGGTGTGCGCCCGGCGGCCCTCCTGGGGCAC
AGTATCGGGGAGCTGGCGGCGGCCACGCTGGCCGGGGTGTTCGCTCCGCGGGACGCCGCC
GGCCTGGTGCTCGACCGGATACGGCGGCTGTCGGCGGCTCCGCCGGGCGGCATGCTCGCG
GTGGCCGCGTCCACGGCGGAGGTGGCCCCGTACCTGAGGGGAGACGTCGTGGTCGGCGCG
GTCAACGCCCCGCGGCAGACCGTGCTCGCCGGACCCGACGGCCCGCTGGACGAGGTGGAC
CGTGCCCTGCGGGAGGCCGGGTTCGTCTGCCGCCGGGTGCCGTCGCTGAGCGCCTTCCAC
AGCCCGGTGCTCGAACCCGCCTGCCGGGGGGCGGCCCCTCTCTTCGCCGCGGCCTGCAAG
CATCCGCCGGCCGTGCCGGTCCACTCCGCCTACACCGCCGCCCCGCTGACGGAGTCAGAC
ATCGACGACCCCGCCTTCTGGGCGCGGCAGCCGGTGGCGCCGGTGCTGTTCTGGCCCGCT
CTGGAAGGGCTGCTGGCCACCGGCGACCATCTGCTGGTGGAGGTGGGGCCGGGACAAGGG
CTGTCCCAGCTGGTCCGCCGTCACCCGGCTGTGCGCCGGGGCGGCAGTGCCGTGGTGTCG
CTGCTTCCGGCGCGGCCGGGGCCGCCGGAGGCGGACCGGGCCGCGGTGGCCGCCGCCACG
GAGCAGATCACGGCGGCGGGGCGCCAGGCCGCCCCCGCGAGCGCGGACCACGGCCGGCCG
TCACGGCAGGCCGCGGCCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [5-133]  3.40000000000004e-48 G3DSA:3.40.366.10 [197-295]  3.40000000000004e-48 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR014043 Acyl transferase (Domain)
 [14-285]  9e-43 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [9-289]  4.30000170645869e-45 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [134-194]  3.50000235434314e-12 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
SignalP
 [1-25]  0.225 Signal
Bacteria, Gram-positive   
 [1-18]  0.972 Signal
Eukaryota   
TMHMM No significant hit