close all open/close all

CDS information : Acla_00120


close this sectionLocation

Organism
StrainATCC 31615
Entry nameAclacinomycin A
Contig
Start / Stop / Direction11,371 / 10,511 / - [in whole cluster]
11,371 / 10,511 / - [in contig]
Locationcomplement(10511..11371) [in whole cluster]
complement(10511..11371) [in contig]
TypeCDS
Length861 bp (286 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
Productputative aklanonic acid O-methyltransferase
Product (GenBank)AknG
Gene
Gene (GenBank)aknG
EC number2.1.1.-
Keyword
Note
Note (GenBank)
  • aklanonic acid methyl transferase
Reference
ACC
PmId
[12137949] Cloning and characterization of Streptomyces galilaeus aclacinomycins polyketide synthase (PKS) cluster. (Gene. , 2002)
Related Reference
ACC
Q54818
NITE
Adria_00310
PmId
[7601857] Functional characterization and transcriptional analysis of a gene cluster governing early and late steps in daunorubicin biosynthesis in Streptomyces peucetius. (J Bacteriol. , 1995)

close this sectionSequence

selected fasta
>putative aklanonic acid O-methyltransferase [AknG]
MDTSTYKSEVAAAFNSAAATYDRLGVEFFTPMGRRLVERAAPAAGARVLDVGCGRGACVF
PAAERVGPEGRVVGIDVAEAMIEEATKEAALRDAAMVELRVMDGEHPDFAPHSFDVVLGS
YSVIFLPDAPTALARYAPLLSPGGRLAFTSPVFSDDTFPFLPPVFTELIPRELLLDLPPQ
WQPEQLQQRFNSWLADPRDLTRTLERCGFQEVTVVDEPVTLVAESGLAWVDWSHTQGMRL
LWNHLAQDKRQQLRERLITSLDAMRDGDGPLTIDTPVRYVTATVRN
selected fasta
>putative aklanonic acid O-methyltransferase [AknG]
GTGGACACGTCCACCTACAAATCCGAAGTGGCGGCCGCCTTCAACAGCGCCGCGGCGACC
TACGACCGGCTCGGCGTGGAATTCTTCACCCCGATGGGCCGGCGTCTGGTGGAACGCGCG
GCACCGGCCGCCGGCGCCCGGGTCCTCGACGTCGGCTGCGGGCGGGGCGCGTGCGTCTTC
CCGGCTGCCGAACGCGTGGGGCCCGAGGGCCGTGTCGTGGGCATCGACGTCGCCGAGGCG
ATGATCGAGGAGGCCACGAAGGAGGCGGCGCTGCGCGACGCCGCCATGGTCGAGCTGCGG
GTGATGGACGGGGAGCACCCCGACTTCGCGCCGCACTCCTTCGACGTGGTCCTGGGCAGC
TACAGCGTCATCTTCCTGCCCGACGCCCCGACGGCGCTGGCCCGTTACGCGCCGCTGCTC
TCCCCCGGGGGCCGACTCGCCTTCACCAGCCCGGTGTTCAGCGACGACACCTTCCCCTTC
CTGCCCCCGGTGTTCACCGAACTGATCCCGCGCGAGCTGCTGCTCGACCTGCCGCCGCAG
TGGCAGCCCGAACAGCTTCAGCAGCGCTTCAACAGCTGGCTCGCGGACCCGCGGGACCTC
ACCCGCACACTGGAGCGGTGCGGCTTCCAAGAGGTGACGGTCGTCGACGAACCCGTGACT
CTGGTGGCCGAATCGGGCCTGGCCTGGGTGGACTGGTCGCACACCCAGGGGATGCGCCTG
CTCTGGAACCACCTGGCGCAGGACAAACGTCAGCAGCTGCGGGAGCGGCTGATCACCTCG
CTCGACGCGATGCGGGACGGGGACGGCCCGCTCACGATCGACACCCCGGTGCGGTACGTC
ACCGCGACCGTACGGAACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit