close all open/close all

CDS information : Acla_00130


close this sectionLocation

Organism
StrainATCC 31615
Entry nameAclacinomycin A
Contig
Start / Stop / Direction11,570 / 12,004 / + [in whole cluster]
11,570 / 12,004 / + [in contig]
Location11570..12004 [in whole cluster]
11570..12004 [in contig]
TypeCDS
Length435 bp (144 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative aklanonic acid methyl ester cyclase
Product (GenBank)AknH
Gene
Gene (GenBank)aknH
EC number
Keyword
  • 4th ring
Note
Note (GenBank)
  • aklanonic acid methyl ester cyclase
Reference
ACC
PmId
[12137949] Cloning and characterization of Streptomyces galilaeus aclacinomycins polyketide synthase (PKS) cluster. (Gene. , 2002)
[10658662] Elucidation of anthracyclinone biosynthesis by stepwise cloning of genes for anthracyclines from three different Streptomyces spp. (Microbiology. , 2000)
[16414075] Crystal structure of the polyketide cyclase AknH with bound substrate and product analogue: implications for catalytic mechanism and product stereoselectivity. (J Mol Biol. , 2006)
Related Reference
ACC
Q54808
NITE
Adria_00320
PmId
[7601857] Functional characterization and transcriptional analysis of a gene cluster governing early and late steps in daunorubicin biosynthesis in Streptomyces peucetius. (J Bacteriol. , 1995)
[10200167] DnrD cyclase involved in the biosynthesis of doxorubicin: purification and characterization of the recombinant enzyme. (Biochemistry. , 1999)
ACC
Q55215
NITE
Dauno_00090
PmId
[7836284] Analysis of clustered genes encoding both early and late steps in daunomycin biosynthesis by Streptomyces sp. strain C5. (J Bacteriol. , 1995)

close this sectionSequence

selected fasta
>putative aklanonic acid methyl ester cyclase [AknH]
MSEQIAAVRRMVEAYNTGKTDDVADYIHPEYMNPGTLEFTSLRGPELFAINVAWVKKTFS
EEARLEEVGIEERADWVRARLVLYGRHVGEMVGMAPTGRLFSGEQIHLLHFVDGKIHHHR
DWPDYQGTYRQLGEPWPETEHRRP
selected fasta
>putative aklanonic acid methyl ester cyclase [AknH]
GTGAGTGAGCAGATAGCGGCCGTTCGGCGCATGGTCGAGGCGTACAACACCGGAAAAACG
GATGATGTGGCCGACTACATCCATCCGGAATACATGAATCCGGGAACCCTGGAATTCACC
TCGCTGCGTGGCCCGGAACTCTTCGCGATCAATGTCGCGTGGGTCAAGAAGACGTTCTCC
GAGGAGGCGCGGCTGGAAGAGGTCGGCATCGAGGAGCGGGCCGACTGGGTGCGCGCCCGG
CTGGTGCTCTACGGCCGGCACGTCGGTGAGATGGTCGGCATGGCGCCGACCGGACGGCTG
TTCTCCGGCGAGCAGATCCATCTCCTGCACTTCGTCGACGGGAAGATCCACCACCACCGC
GACTGGCCCGACTACCAGGGCACCTACCGCCAGCTCGGCGAGCCGTGGCCGGAGACCGAG
CACCGCCGTCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009959 Polyketide cyclase SnoaL-like domain (Domain)
 [7-132]  1.9e-34 PF07366
PF07366   SnoaL
SignalP No significant hit
TMHMM No significant hit