close all open/close all

CDS information : Acla_00140


close this sectionLocation

Organism
StrainATCC 31615
Entry nameAclacinomycin A
Contig
Start / Stop / Direction12,048 / 12,890 / + [in whole cluster]
12,048 / 12,890 / + [in contig]
Location12048..12890 [in whole cluster]
12048..12890 [in contig]
TypeCDS
Length843 bp (280 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative transcriptional regulator
Product (GenBank)AknI
Gene
Gene (GenBank)aknI
EC number
Keyword
  • SARP family
Note
Note (GenBank)
  • regulator
Reference
ACC
PmId
[12137949] Cloning and characterization of Streptomyces galilaeus aclacinomycins polyketide synthase (PKS) cluster. (Gene. , 2002)
Related Reference
ACC
Q83X29
PmId
[12791134] The large linear plasmid pSLA2-L of Streptomyces rochei has an unusually condensed gene organization for secondary metabolism. (Mol Microbiol. , 2003)
[20378964] Regulation of lankamycin biosynthesis in Streptomyces rochei by two SARP genes, srrY and srrZ. (Biosci Biotechnol Biochem. , 2010)
ACC
P25047
NITE
Adria_00210
PmId
[1729206] Regulation of secondary metabolism in Streptomyces spp. and overproduction of daunorubicin in Streptomyces peucetius. (J Bacteriol. , 1992)
[7868593] Functional characterization and transcriptional analysis of the dnrR1 locus, which controls daunorubicin biosynthesis in Streptomyces peucetius. (J Bacteriol. , 1995)
[8971703] Purification and characterization of the DNA-binding protein DnrI, a transcriptional factor of daunorubicin biosynthesis in Streptomyces peucetius. (Mol Microbiol. , 1996)
[16545946] Feedback regulation of doxorubicin biosynthesis in Streptomyces peucetius. (Res Microbiol. , 2006)
[20529134] Modulation of dnrN expression by intracellular levels of DnrO and daunorubicin in Streptomyces peucetius. (FEMS Microbiol Lett. , 2010)
[20158521] Daunorubicin efflux in Streptomyces peucetius modulates biosynthesis by feedback regulation. (FEMS Microbiol Lett. , 2010)
ACC
Q194R8
NITE
Mith_00020
PmId
[9882681] The mithramycin gene cluster of Streptomyces argillaceus contains a positive regulatory gene and two repeated DNA sequences that are located at both ends of the cluster. (J Bacteriol. , 1999)

close this sectionSequence

selected fasta
>putative transcriptional regulator [AknI]
MEFGVLGPLYVRVNGATTAPSAPKLRNVLAMLLVHAGQVVPVPSLVRDLWDEDPPVSGLT
TLQTYILNLRKMFSAVTGLTTAEVARDVLVTRAGGYALAAEAGVLDIHRYQRLVTSGREA
LARGDDAAGVRDLNEALLLWRGPALADVPAGRVLESRRRQLEESRLAAFEYLVDVELRLG
MYREVLAELAALTVENPLHEGLHGQYMWALHLSGRRAQALQVFHRLRGALVAGLGLEPGP
QVQRLHQAVLNADTAFEPRFTVRRTAVAASATAFGGGRSY
selected fasta
>putative transcriptional regulator [AknI]
ATGGAGTTCGGTGTTCTGGGACCGCTGTACGTGCGGGTGAACGGTGCGACCACCGCGCCG
AGCGCCCCGAAACTGCGGAACGTGCTGGCGATGCTGCTCGTCCACGCGGGGCAGGTGGTG
CCTGTGCCGTCGCTGGTGCGGGACCTGTGGGACGAGGATCCGCCGGTCAGCGGCCTGACC
ACGCTGCAGACGTACATCCTGAACCTGCGCAAGATGTTCTCCGCGGTCACCGGACTGACC
ACCGCGGAGGTGGCCCGCGACGTCCTGGTGACCCGTGCGGGCGGATACGCGCTGGCCGCG
GAGGCCGGCGTGCTCGACATCCACCGCTACCAGCGCCTCGTGACCTCCGGCCGAGAGGCC
CTGGCGCGCGGTGACGACGCGGCCGGGGTTCGGGACCTGAACGAGGCGCTGCTGCTGTGG
CGGGGCCCCGCGCTGGCGGACGTACCGGCGGGGCGGGTGCTGGAGAGCAGGCGCCGGCAG
CTGGAGGAGTCCCGGCTCGCCGCCTTCGAATACCTGGTCGACGTGGAGCTGCGGCTCGGC
ATGTACCGCGAGGTGCTCGCCGAGCTGGCCGCCCTCACGGTGGAGAACCCGCTGCACGAG
GGGCTGCACGGCCAGTACATGTGGGCCCTGCACCTCAGCGGGCGGCGGGCCCAGGCGTTG
CAGGTCTTCCACCGGCTGCGGGGTGCGCTGGTGGCGGGTCTCGGCCTGGAGCCGGGTCCG
CAGGTGCAGCGGCTGCACCAGGCGGTGCTGAACGCGGACACCGCCTTCGAACCCCGCTTC
ACCGTGCGCCGGACCGCGGTCGCCGCGTCGGCCACGGCCTTCGGGGGCGGACGGTCGTAC
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001867 Signal transduction response regulator, C-terminal (Domain)
 [15-98]  1.30000067202732e-07 SM00862
SM00862   Trans_reg_C
 [19-98]  3.5e-15 PF00486
PF00486   Trans_reg_C
IPR005158 Bacterial transcriptional activator domain (Domain)
 [105-250]  2.99998750445706e-49 SM01043
SM01043   BTAD
 [105-250]  4.2e-48 PF03704
PF03704   BTAD
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [23-100]  6.80000000000001e-07 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [1-99]  7.60000011115812e-12 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP
 [1-36]  0.368 Signal
Bacteria, Gram-positive   
TMHMM No significant hit