close all open/close all

CDS information : Acla_00150


close this sectionLocation

Organism
StrainATCC 31615
Entry nameAclacinomycin A
Contig
Start / Stop / Direction13,513 / 15,150 / + [in whole cluster]
13,513 / 15,150 / + [in contig]
Location13513..15150 [in whole cluster]
13513..15150 [in contig]
TypeCDS
Length1,638 bp (545 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productaclacinomycin oxidoreductase
FAD-dependent oxidoreductase
Product (GenBank)aclacinomycin oxidoreductase
Gene
Gene (GenBank)aknOx
EC number
Keyword
  • cinerulose A
  • L-aculose
Note
Note (GenBank)
Reference
ACC
PmId
[17242508] Structure determination by multiwavelength anomalous diffraction of aclacinomycin oxidoreductase: indications of multidomain pseudomerohedral twinning. (Acta Crystallogr D Biol Crystallogr. , 2007)
[17395717] Aclacinomycin oxidoreductase (AknOx) from the biosynthetic pathway of the antibiotic aclacinomycin is an unusual flavoenzyme with a dual active site. (Proc Natl Acad Sci U S A. , 2007)

close this sectionSequence

selected fasta
>aclacinomycin oxidoreductase [aclacinomycin oxidoreductase]
MFVLNEFTRRGFLGTAAAVGGTTVVTTALGGAPAAQAAVPEAADGGACGARTALVKVDRV
DRRYQDLVTRGFNGRFRGRPDVVYVVHTADQVVDAVNQAMAAGQRIAVRSGGHCFEGFVD
DPAVRAVIDMSQMRQVFYDSGKRAFAVEPGATLGETYRALYLDWGVTIPAGVCPQVGVGG
HVLGGGYGPLSRRDGVVADHLYAVEVVVVDASGRARKVVATSAADDPNRELWWAHTGGGG
GNFGIVTRYWFRTPGATGTDPSQLLPKAPTSTLRHIVTWDWSALTEEAFTRIIDNHGAWH
QSNSAAGTPYASMHSVFYLNSRAAGQILLDIQIDGGLDGAEALLNDFVAAVNEGTGVEPA
VQRSTEPWLRATLANKFDTGGFDRTKSKGAYLRKPWTAAQAATLYRHLSADSQVWGEVSL
YSYGGKVNSVPETATATAQRDSIIKVWMSATWMDPAHDDANLAWIREIYREIFATTGGVP
VPDDRTEGTFINYPDVDLVDERWNTSGVPWYTLYYKGNYPRLQKVKARWDPRDVFRHALS
VRPPG
selected fasta
>aclacinomycin oxidoreductase [aclacinomycin oxidoreductase]
GTGTTTGTGTTGAACGAATTCACGCGCCGCGGATTCCTCGGCACCGCGGCAGCGGTCGGC
GGAACCACCGTGGTGACCACGGCCCTGGGCGGAGCCCCGGCCGCCCAGGCGGCCGTCCCG
GAAGCGGCGGACGGTGGCGCGTGCGGCGCGCGGACCGCGCTGGTGAAGGTGGACCGGGTG
GACCGGCGCTACCAGGACCTGGTCACCAGGGGCTTCAACGGGCGCTTCCGCGGCCGGCCC
GACGTCGTGTACGTCGTCCACACCGCGGACCAGGTCGTCGACGCGGTGAACCAGGCCATG
GCCGCGGGCCAGCGGATCGCGGTGCGCAGCGGCGGGCACTGCTTCGAGGGCTTCGTGGAC
GATCCCGCCGTCCGGGCCGTCATCGACATGTCCCAGATGAGGCAGGTCTTCTACGACTCC
GGCAAGCGGGCGTTCGCCGTGGAACCCGGCGCCACCCTCGGGGAGACGTACCGGGCCCTG
TATCTGGACTGGGGCGTGACCATCCCGGCCGGCGTCTGCCCCCAGGTGGGCGTCGGCGGC
CATGTGCTGGGCGGAGGCTACGGTCCGCTGTCCCGCCGGGACGGCGTGGTGGCCGACCAT
CTGTACGCGGTCGAGGTCGTCGTCGTGGACGCCTCGGGCCGGGCCCGCAAGGTCGTGGCC
ACGAGCGCCGCGGACGACCCCAACCGAGAGCTGTGGTGGGCCCACACCGGCGGCGGCGGA
GGCAACTTCGGGATCGTCACCCGGTACTGGTTCCGCACCCCCGGGGCCACCGGCACCGAC
CCGTCCCAACTCCTGCCCAAGGCCCCCACGTCCACCCTGCGCCACATCGTGACCTGGGAC
TGGTCCGCTCTCACCGAGGAGGCGTTCACCCGGATCATCGACAACCACGGGGCCTGGCAC
CAGAGCAACAGCGCCGCCGGCACCCCGTACGCCAGCATGCACAGCGTCTTCTACCTCAAC
AGCCGTGCGGCCGGTCAGATCCTGCTGGACATCCAGATCGACGGCGGCCTGGACGGCGCC
GAGGCCCTGCTGAACGACTTCGTGGCCGCGGTCAACGAGGGCACCGGCGTCGAGCCCGCC
GTGCAGCGGAGCACGGAGCCGTGGCTGCGCGCCACGCTGGCCAACAAGTTCGACACCGGC
GGCTTCGACCGGACCAAGTCGAAGGGCGCGTATCTGCGCAAGCCCTGGACCGCCGCCCAG
GCCGCCACTCTCTACCGCCATCTGAGCGCCGACTCCCAGGTCTGGGGAGAGGTCTCGCTC
TACTCGTACGGAGGCAAGGTCAACTCCGTGCCGGAGACGGCCACGGCCACGGCCCAGCGC
GACTCCATCATCAAGGTGTGGATGTCGGCGACCTGGATGGATCCCGCCCACGACGATGCC
AACCTCGCCTGGATCCGGGAGATCTACCGCGAGATCTTCGCCACCACCGGCGGCGTTCCG
GTGCCCGACGACCGCACGGAGGGCACCTTCATCAACTATCCCGACGTCGACCTGGTCGAC
GAGCGGTGGAACACCTCGGGAGTCCCCTGGTACACCCTCTACTACAAGGGGAACTACCCG
CGCCTGCAGAAGGTCAAGGCGCGCTGGGATCCCCGTGACGTCTTCCGGCACGCGCTGTCC
GTGCGGCCGCCCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006094 FAD linked oxidase, N-terminal (Domain)
 [80-214]  1.6e-19 PF01565
PF01565   FAD_binding_4
IPR006311 Twin-arginine translocation pathway, signal sequence (Conserved_site)
 [1-37]  PS51318
PS51318   TAT
IPR012951 Berberine/berberine-like (Domain)
 [490-542]  2.4e-17 PF08031
PF08031   BBE
IPR016166 FAD-binding, type 2 (Domain)
 [61-257]  2.1000026783403e-36 SSF56176
SSF56176   FAD-binding_2
 [76-256]  PS51387
PS51387   FAD_PCMH
IPR016167 FAD-binding, type 2, subdomain 1 (Domain)
 [72-134]  0.00027 G3DSA:3.30.43.10
G3DSA:3.30.43.10   FAD-binding_2_sub1
IPR016168 FAD-linked oxidase, FAD-binding, subdomain 2 (Domain)
 [139-252]  7.90000000000001e-07 G3DSA:3.30.465.20
G3DSA:3.30.465.20   FAD-linked_oxidase_FAD-bd_sub2
SignalP
 [1-37]  0.999 Signal
Bacteria, Gram-negative   
 [1-37]  0.745 Signal
Eukaryota   
 [1-37]  1 Signal
Bacteria, Gram-positive   
TMHMM No significant hit