close all open/close all

CDS information : Acla_00160


close this sectionLocation

Organism
StrainATCC 31615
Entry nameAclacinomycin A
Contig
Start / Stop / Direction18,141 / 16,156 / - [in whole cluster]
1,986 / 1 / - [in contig]
Locationcomplement(16156..18141) [in whole cluster]
complement(1..1986) [in contig]
TypeCDS
Length1,986 bp (661 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.2 function unknown
Productbacteriocin biosynthesis cyclodehydratase domain protein(fragment)
Product (GenBank)AknN
Gene
Gene (GenBank)aknN
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11016846] A gene cluster from Streptomyces galilaeus involved in glycosylation of aclarubicin. (Mol Gen Genet. , 2000)
Related Reference
ACC
Q52QI6
PmId
[15883371] Patellamide A and C biosynthesis by a microcin-like pathway in Prochloron didemni, the cyanobacterial symbiont of Lissoclinum patella. (Proc Natl Acad Sci U S A. , 2005)
Family/Domain
FD
IPR022291

close this sectionSequence

selected fasta
>bacteriocin biosynthesis cyclodehydratase domain protein(fragment) [AknN]
MTEDRVTTLGGEQIALLAPLLDGSRDLPGIVADAAPRLPAGLAERLVTRLLDAGLLCAYP
QDGADRPERAYRSLTGLQARSADARDAVLAAVDLTGDAESPLPEAVSAAGLRAAAPGEHA
ALTLVLCHDYLDPRLSALDAEHRATGRGWLPVRANGTHLWIGPFFSAGDGPCWSCLADRL
RLRRRGEAYVQHRLGHSGPAVHRRAYLPAGRAAALQLALLEAGKWLSGHRDTVQDSLWRL
DTRTLESSRHPVRRRPQCSRCGDPLLVRDRVSAPVVLSSRPVRDESGGGHRTFGPQEMLD
RYGHLVDPVTGVVGEIRRDPRGPEFLNCFTRSRCRLGPRAAPPALHSPLRSPGSGKGVTE
LHARVSALAEALERCSGYFQGDEPRRRGSYRELAGLAVHPDSVQLFDRRQFEDRRAWNRA
HGPFHQVTEPFDEDAPIDWTPVWSLTERRQRLAPTSLLYYNAPDADTGFCRATSNGAAAG
TSLEDAVVHGCLELVERDAIALWWYNRTRQPGVTLDARDPWITRLRAVLRDLGRTVWALD
LTSDLGIPVVAAVSVRTGGTAEDIVLGFGAHFDPRIALRRALTELSQMLPPLAQETAGDA
SAYTGTDPEAMRWFRHATTANQPYLLPAARRSARPPASLRPPRDAAAQAGALVALLRRHG
LE
selected fasta
>bacteriocin biosynthesis cyclodehydratase domain protein(fragment) [AknN]
ATGACCGAGGACCGGGTGACCACGCTGGGCGGGGAGCAGATCGCCCTGCTGGCCCCGCTG
CTCGACGGCAGCCGCGATCTGCCGGGCATCGTCGCCGACGCGGCACCCCGGCTGCCGGCC
GGACTCGCCGAGCGGCTCGTGACCCGGCTGCTGGACGCGGGACTGCTGTGCGCCTATCCC
CAGGACGGGGCCGACCGCCCCGAACGGGCCTACCGGTCCCTCACCGGTCTTCAGGCGCGG
TCCGCCGACGCGCGGGACGCGGTCCTGGCCGCGGTCGACCTCACCGGTGACGCGGAATCC
CCGCTGCCCGAGGCCGTGTCCGCGGCGGGGCTGCGCGCCGCGGCACCGGGCGAGCACGCC
GCTCTGACCCTGGTGCTCTGTCACGACTACCTCGACCCGCGGCTGAGTGCCCTGGACGCG
GAGCACCGCGCGACGGGACGCGGCTGGCTGCCCGTCCGGGCCAACGGCACCCACCTGTGG
ATCGGCCCGTTCTTCTCCGCCGGCGACGGCCCCTGCTGGAGCTGTCTGGCGGACCGGCTC
CGGCTGCGCCGGCGCGGTGAGGCGTACGTGCAGCACCGGCTGGGGCACAGCGGTCCGGCC
GTGCACCGGCGGGCCTACCTGCCCGCGGGGCGTGCCGCGGCCCTGCAACTGGCCCTGCTG
GAAGCCGGAAAGTGGCTCTCCGGACACCGCGACACGGTGCAGGACAGCCTCTGGCGCCTG
GACACCCGCACGCTGGAGAGCAGTCGCCATCCCGTGCGGCGCCGCCCGCAGTGCTCCCGC
TGCGGCGATCCGCTGCTGGTACGCGACCGGGTCTCGGCACCCGTGGTGCTGTCCTCCCGG
CCGGTGCGGGACGAGAGCGGCGGTGGTCACCGCACGTTCGGTCCGCAGGAGATGCTGGAC
CGCTACGGCCATCTCGTGGACCCCGTCACCGGCGTTGTCGGCGAGATCCGCCGGGATCCG
CGCGGACCGGAGTTCCTCAACTGCTTCACGCGGTCGCGCTGCCGTCTGGGACCCCGCGCT
GCACCGCCGGCGCTCCACTCCCCGCTGCGCAGCCCGGGATCCGGCAAGGGCGTCACCGAA
CTCCACGCCAGGGTCAGCGCGCTGGCCGAGGCGCTGGAGCGGTGCAGCGGCTACTTCCAG
GGCGACGAACCGCGCCGGCGCGGCAGTTACCGCGAGCTGGCCGGTCTCGCCGTGCATCCG
GACAGCGTCCAGCTCTTCGACCGCAGACAGTTCGAGGACCGGCGGGCGTGGAACCGCGCG
CACGGTCCCTTCCACCAGGTGACCGAGCCCTTCGACGAGGACGCCCCGATCGACTGGACC
CCCGTCTGGTCACTGACCGAGCGGCGGCAGCGGCTCGCGCCCACGAGTCTGCTCTACTAC
AACGCCCCGGACGCGGACACTGGCTTCTGCCGGGCCACGTCCAACGGAGCCGCCGCCGGA
ACGAGCCTGGAGGACGCCGTCGTGCACGGCTGCCTGGAACTCGTGGAACGGGACGCGATC
GCCCTGTGGTGGTACAACCGCACGCGCCAGCCCGGCGTGACCCTGGACGCGCGGGATCCG
TGGATCACGCGGCTCCGGGCCGTCCTGCGCGATCTGGGCAGGACGGTGTGGGCCCTCGAC
CTCACGTCCGATCTCGGCATTCCCGTGGTCGCCGCCGTGTCGGTGCGGACGGGCGGCACC
GCCGAGGACATCGTGCTGGGCTTCGGCGCGCACTTCGATCCGCGTATCGCCCTGCGCCGG
GCTCTCACCGAACTCAGCCAGATGCTCCCGCCGTTGGCGCAGGAGACGGCCGGCGACGCC
TCCGCGTACACCGGCACGGACCCCGAGGCCATGCGCTGGTTCCGGCACGCCACCACGGCA
AACCAGCCGTATCTCCTGCCCGCGGCGCGCCGGTCCGCCCGGCCCCCTGCCTCGCTGCGG
CCTCCCCGCGACGCCGCGGCACAGGCCGGGGCCCTCGTCGCCCTGCTGCGCCGGCACGGC
CTCGAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003776 YcaO-like (Domain)
 [354-662]  4.30000000000003e-77 PF02624
PF02624   YcaO
 [354-587]  1.4e-27 TIGR00702
TIGR00702   TIGR00702
IPR016040 NAD(P)-binding domain (Domain)
 [125-262]  0.00021 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR022291 Bacteriocin biosynthesis, cyclodehydratase domain (Domain)
 [148-313]  1.6e-44 TIGR03882
TIGR03882   Cyclo_dehyd_2
SignalP
 [1-34]  0.184 Signal
Bacteria, Gram-positive   
TMHMM No significant hit