close all open/close all

CDS information : Acla_00180


close this sectionLocation

Organism
StrainATCC 31615
Entry nameAclacinomycin A
Contig
Start / Stop / Direction20,814 / 19,510 / - [in whole cluster]
4,659 / 3,355 / - [in contig]
Locationcomplement(19510..20814) [in whole cluster]
complement(3355..4659) [in contig]
TypeCDS
Length1,305 bp (434 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative pyridoxamine 5'-monophosphate-dependent NDP-hexose C-3 dehydratase
Product (GenBank)putative 3-dehydratase
Gene
Gene (GenBank)aknP
EC number
Keyword
  • L-rhodinose
Note
Note (GenBank)
  • AknP
Reference
ACC
PmId
[11016846] A gene cluster from Streptomyces galilaeus involved in glycosylation of aclarubicin. (Mol Gen Genet. , 2000)
[12427929] Characterization of mutations in aclacinomycin A-non-producing Streptomyces galilaeus strains with altered glycosylation patterns. (Microbiology. , 2002)
Related Reference
ACC
Q9ALN8
NITE
Spino_00050
PmId
[17076492] Characterization of SpnQ from the spinosyn biosynthetic pathway of Saccharopolyspora spinosa: mechanistic and evolutionary implications for C-3 deoxygenation in deoxysugar biosynthesis. (J Am Chem Soc. , 2006)
[18345667] In vitro characterization of the enzymes involved in TDP-D-forosamine biosynthesis in the spinosyn pathway of Saccharopolyspora spinosa. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>putative pyridoxamine 5'-monophosphate-dependent NDP-hexose C-3 dehydratase [putative 3-dehydratase]
MTSDTKALVLEQVREYHRQQQPGNFQPGVTPILSSGAVLDEEDRVALVEAALDLRIAAGA
HSRRFESKFARHIGVRKAHLVNSGSSANLLALSALTSPRLGEQRLRPGDEVITVAGGFPT
TVNPILQNGLTPVFVDLELGTYNTTVEHVRAAISDRTRAIMIAHTLGNPYQVAEIQQLAT
EHELFLIEDNCDAVGSTYQGRMTGTFGDLATVSFYPAHHITTGEGGCVLTRNLELARIVE
SFRDWGRDCWCEPGEDNTCLKRFDYQLGNLPKGYDHKYIFSHIGYNLKATDLQGALALSQ
LNKLPEFGAARRRNWQRLRDGLADVPGLLLPVATPGSDPSWFGFVITVLPDATYTRRDLV
AFLEERRIGTRRLFGGNLTRHPAYLGTPHRVAGDLRNSDIITEQSFWIGVYPGITEEMTD
YMRESIVEFVTKNG
selected fasta
>putative pyridoxamine 5'-monophosphate-dependent NDP-hexose C-3 dehydratase [putative 3-dehydratase]
ATGACGTCGGACACCAAGGCTCTGGTCCTGGAGCAGGTTCGCGAGTATCACCGGCAGCAG
CAGCCAGGGAATTTCCAGCCCGGAGTGACGCCCATCCTCTCCTCGGGCGCCGTCCTGGAC
GAGGAGGACCGGGTCGCCCTGGTGGAGGCCGCCCTGGATCTGCGGATCGCGGCCGGAGCC
CACTCCCGGCGCTTCGAGAGCAAATTCGCCCGCCACATCGGCGTACGCAAGGCGCACCTG
GTGAACTCGGGGTCCTCGGCGAACCTGCTGGCGCTCTCTGCGCTGACCTCTCCCCGGCTC
GGTGAGCAGCGGCTGCGTCCGGGTGACGAGGTGATCACGGTGGCCGGCGGATTCCCCACC
ACGGTGAACCCGATCCTCCAGAACGGGCTGACGCCCGTGTTCGTGGACCTGGAACTCGGT
ACGTACAACACAACGGTGGAGCACGTGCGGGCGGCGATCTCGGACCGGACCCGGGCCATC
ATGATCGCGCACACCCTCGGCAACCCCTACCAGGTGGCGGAGATCCAGCAACTGGCCACC
GAGCACGAGCTGTTCCTGATCGAGGACAACTGCGACGCGGTGGGCTCGACCTACCAGGGA
CGTATGACGGGGACCTTCGGGGACCTGGCAACGGTCAGTTTCTATCCTGCCCACCACATC
ACCACGGGCGAGGGGGGCTGCGTACTGACCCGCAACCTCGAACTGGCCCGCATCGTCGAG
TCGTTCCGCGACTGGGGCCGGGACTGCTGGTGCGAACCGGGCGAGGACAACACCTGCCTC
AAGCGGTTCGACTACCAGCTGGGTAATCTCCCCAAGGGCTACGACCACAAGTACATCTTC
TCCCACATCGGTTACAACCTGAAGGCGACCGATCTGCAAGGGGCGCTGGCACTCAGCCAG
TTGAACAAGCTGCCGGAGTTCGGCGCGGCCCGGCGGCGCAACTGGCAGCGGCTGCGGGAC
GGGCTCGCCGACGTCCCCGGTCTGCTGCTGCCGGTCGCGACACCGGGCAGCGATCCCAGC
TGGTTCGGGTTCGTGATCACGGTCCTGCCCGACGCCACCTACACCCGCCGTGACCTGGTC
GCCTTCCTGGAGGAACGGCGGATCGGCACACGGCGGCTGTTCGGCGGCAACCTCACCCGC
CATCCGGCGTACCTCGGCACGCCGCACCGGGTGGCGGGCGATCTGCGCAACTCCGACATC
ATCACCGAGCAGAGCTTCTGGATCGGGGTGTATCCGGGCATCACGGAGGAGATGACCGAC
TACATGCGGGAGTCCATCGTCGAGTTCGTCACCAAGAACGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000653 DegT/DnrJ/EryC1/StrS aminotransferase (Family)
 [1-434]  8.79996401030984e-117 PIRSF000390
PIRSF000390   PLP_StrS
 [41-426]  1.69999999999998e-100 PF01041
PF01041   DegT_DnrJ_EryC1
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (Domain)
 [32-302]  1.9e-71 G3DSA:3.40.640.10
G3DSA:3.40.640.10   PyrdxlP-dep_Trfase_major_sub1
IPR015422 Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (Domain)
 [303-426]  1.09999999999999e-47 G3DSA:3.90.1150.10
G3DSA:3.90.1150.10   PyrdxlP-dep_Trfase_major_sub2
IPR015424 Pyridoxal phosphate-dependent transferase, major domain (Domain)
 [26-433]  3.19999899046355e-93 SSF53383
SSF53383   PyrdxlP-dep_Trfase_major
SignalP No significant hit
TMHMM No significant hit