close all open/close all

CDS information : Acla_00190


close this sectionLocation

Organism
StrainATCC 31615
Entry nameAclacinomycin A
Contig
Start / Stop / Direction20,976 / 21,965 / + [in whole cluster]
4,821 / 5,810 / + [in contig]
Location20976..21965 [in whole cluster]
4821..5810 [in contig]
TypeCDS
Length990 bp (329 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-3 ketoreductase
Product (GenBank)putative 3-ketoreductase
Gene
Gene (GenBank)aknQ
EC number
Keyword
  • L-2-deoxyfucose
  • L-rhodinose
Note
Note (GenBank)
  • AknQ
Reference
ACC
PmId
[11016846] A gene cluster from Streptomyces galilaeus involved in glycosylation of aclarubicin. (Mol Gen Genet. , 2000)
[12427929] Characterization of mutations in aclacinomycin A-non-producing Streptomyces galilaeus strains with altered glycosylation patterns. (Microbiology. , 2002)
Related Reference
ACC
Q9ALN5
NITE
Spino_00080
PmId
[18345667] In vitro characterization of the enzymes involved in TDP-D-forosamine biosynthesis in the spinosyn pathway of Saccharopolyspora spinosa. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>putative NDP-hexose C-3 ketoreductase [putative 3-ketoreductase]
MPKDTPRPVLRIGVLGCADIAVRRILPAIVEHPSVRLVALASRDGARAERLAARFGCAAV
TGYKALLDREDINAVYVPLPPGMHHEWVTEALTAGKHVLVEKPLSTTYAQSVDLVAMAGR
LGLALTENFMFLHHSQHEAVRAMTGEIGELRVFTSSFGVPPPHPSSFRHDARLGGGALLD
VGVYPLRAAQLHLAGELDVLGACLRVDEATGVDVAGSALLSTATGVTAQLDFGFQHAYRS
VYALWGSRGRLSVPRAFTPPREHRPVVRIEQQDRLTEVTLPADHQVGNALDAFASAVHSE
TVRASLGEALLRQALLVEQVRKAARVVSG
selected fasta
>putative NDP-hexose C-3 ketoreductase [putative 3-ketoreductase]
ATGCCGAAGGACACTCCACGGCCCGTACTCCGCATCGGGGTTCTGGGCTGTGCCGATATC
GCGGTGCGCCGGATCCTGCCCGCGATCGTGGAGCATCCGTCGGTCCGGCTGGTCGCTCTG
GCGAGCCGGGACGGGGCGCGCGCCGAACGGCTCGCGGCCCGTTTCGGATGCGCGGCGGTG
ACCGGCTACAAGGCGCTGCTGGACCGTGAGGACATCAACGCCGTCTACGTTCCCCTGCCG
CCCGGCATGCACCACGAATGGGTCACCGAAGCGCTGACGGCGGGCAAGCACGTGCTGGTG
GAGAAGCCGCTCAGCACGACGTACGCGCAGAGCGTCGACCTGGTGGCGATGGCCGGCCGG
CTCGGCCTCGCGCTCACCGAGAACTTCATGTTCCTGCACCACTCGCAGCACGAGGCGGTC
CGGGCCATGACCGGCGAGATCGGGGAACTGCGGGTCTTCACCAGTTCCTTCGGCGTGCCG
CCGCCCCACCCCTCGTCCTTCCGGCACGACGCGCGGCTCGGCGGCGGCGCCCTGCTGGAC
GTCGGTGTCTATCCGCTGCGCGCGGCCCAGCTCCACCTCGCCGGGGAACTCGACGTGCTG
GGCGCCTGTCTGCGCGTGGACGAGGCGACCGGCGTCGACGTCGCGGGAAGCGCGCTGCTG
TCCACGGCGACGGGTGTGACCGCGCAGCTCGACTTCGGCTTCCAGCACGCGTACCGGTCC
GTGTACGCGCTGTGGGGCAGCCGCGGCAGGCTGAGCGTGCCGCGGGCCTTCACCCCGCCC
CGTGAGCACCGCCCGGTGGTCCGTATCGAACAGCAGGACCGTCTCACCGAAGTGACGCTG
CCCGCCGATCACCAGGTGGGCAACGCGCTCGACGCGTTCGCCTCGGCGGTGCACTCGGAG
ACCGTCCGTGCCTCCCTGGGGGAGGCGCTGCTGCGTCAGGCGCTCCTGGTCGAGCAGGTA
CGCAAAGCCGCGCGGGTCGTCAGCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000683 Oxidoreductase, N-terminal (Domain)
 [10-126]  1.8e-27 PF01408
PF01408   GFO_IDH_MocA
IPR004104 Oxidoreductase, C-terminal (Domain)
 [144-242]  1.3e-10 PF02894
PF02894   GFO_IDH_MocA_C
IPR016040 NAD(P)-binding domain (Domain)
 [9-153]  1.2e-39 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit