close all open/close all

CDS information : Acla_00200


close this sectionLocation

Organism
StrainATCC 31615
Entry nameAclacinomycin A
Contig
Start / Stop / Direction23,047 / 22,076 / - [in whole cluster]
6,892 / 5,921 / - [in contig]
Locationcomplement(22076..23047) [in whole cluster]
complement(5921..6892) [in contig]
TypeCDS
Length972 bp (323 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative dTDP-glucose 4,6-dehydratase
Product (GenBank)putative dTDP-glucose 4, 6-dehydratase
Gene
Gene (GenBank)aknR
EC number4.2.1.46
Keyword
  • L-rhodosamine
  • L-2-deoxyfucose
  • L-rhodinose
Note
Note (GenBank)
  • AknR
Reference
ACC
PmId
[11016846] A gene cluster from Streptomyces galilaeus involved in glycosylation of aclarubicin. (Mol Gen Genet. , 2000)
Related Reference
ACC
Q56173
NITE
Grana_00110
PmId
[7476861] Identification of Streptomyces violaceoruber Tu22 genes involved in the biosynthesis of granaticin. (Mol Gen Genet. , 1995)
[9831526] The granaticin biosynthetic gene cluster of Streptomyces violaceoruber Tu22: sequence analysis and expression in a heterologous host. (Chem Biol. , 1998)

close this sectionSequence

selected fasta
>putative dTDP-glucose 4,6-dehydratase [putative dTDP-glucose 4, 6-dehydratase]
MRVLITGGAGFIGSHYVRSLLAGTLPGPRPSRVTVVDLLTYAGDTGNLPLADPRLDFRRL
DIRDLDALLTVVPGHDAVVHFAAETHVDRSLSEPAEFVRTNVLGTQSLLEASLRGGVGTF
VHVSTDEVYGSIAQGTWTEEAPLLPNSPYAASKAGSDLVARSYWRTHGLDVRTTRCANNY
GPRQHPEKLIPLFVTELLAGRPVPLYGDGGNVREWLHVDDHCRAVHAVLTGGRPGEIYNI
GGGTHLTNREMTAKLLALCGTDWSRVRQVPDRKGHDLRYAVDDTKIREELGYRPLRSLDD
GLREVVDWYRDRQTHRPEPAERV
selected fasta
>putative dTDP-glucose 4,6-dehydratase [putative dTDP-glucose 4, 6-dehydratase]
ATGCGTGTCCTGATCACCGGCGGCGCCGGTTTCATCGGATCCCACTACGTCCGTTCCCTG
CTGGCGGGGACCCTGCCCGGTCCCCGCCCGAGCCGGGTCACCGTCGTCGACCTGCTCACG
TACGCGGGAGACACCGGCAATCTGCCCCTGGCCGATCCCCGGCTGGACTTCCGCCGGCTC
GACATCCGCGACCTGGACGCGCTGCTGACGGTGGTCCCCGGCCACGACGCGGTCGTACAC
TTCGCGGCCGAGACCCATGTCGACCGTTCGCTGAGCGAGCCGGCGGAGTTCGTCCGCACC
AACGTACTGGGCACCCAGTCGCTGCTGGAGGCGAGCCTGCGCGGCGGGGTCGGCACGTTC
GTGCACGTCTCCACGGACGAGGTCTACGGATCGATCGCGCAGGGCACCTGGACGGAGGAG
GCGCCGCTGCTCCCCAACTCCCCCTACGCGGCCTCGAAGGCGGGAAGCGACCTGGTCGCA
CGGTCCTACTGGCGCACCCACGGCCTCGATGTGCGCACGACCCGCTGCGCCAACAACTAC
GGCCCCCGTCAGCACCCGGAGAAGCTCATCCCGCTGTTCGTCACCGAACTGCTGGCCGGC
CGGCCGGTGCCGCTGTACGGCGACGGAGGCAACGTCAGGGAATGGCTGCACGTGGACGAC
CACTGCCGGGCCGTCCACGCGGTGCTGACCGGTGGCCGGCCCGGCGAGATCTACAACATC
GGCGGCGGTACCCATCTGACGAACCGTGAGATGACGGCCAAGCTGCTCGCGCTGTGCGGC
ACCGACTGGTCCAGGGTCCGCCAGGTGCCCGACCGCAAGGGCCACGACCTGCGGTACGCG
GTGGACGACACGAAGATCCGCGAAGAACTCGGCTACCGGCCGCTGCGGTCCCTGGACGAC
GGTCTGCGCGAGGTCGTCGACTGGTACCGCGACCGGCAGACCCACCGGCCGGAACCGGCC
GAGCGGGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [3-241]  5.19999999999996e-62 PF01370
PF01370   Epimerase
IPR005888 dTDP-glucose 4,6-dehydratase (Family)
 [2-314]  1.29999999999998e-113 TIGR01181
TIGR01181   DTDP_gluc_dehyt
IPR016040 NAD(P)-binding domain (Domain)
 [1-178]  1.99999999999999e-61 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-22]  0.583 Signal
Eukaryota   
 [1-22]  0.146 Signal
Bacteria, Gram-negative   
TMHMM No significant hit