close all open/close all

CDS information : Acla_00210


close this sectionLocation

Organism
StrainATCC 31615
Entry nameAclacinomycin A
Contig
Start / Stop / Direction24,366 / 23,035 / - [in whole cluster]
8,211 / 6,880 / - [in contig]
Locationcomplement(23035..24366) [in whole cluster]
complement(6880..8211) [in contig]
TypeCDS
Length1,332 bp (443 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductdTDP-L-rhodosamine glycosyltransferase
Product (GenBank)putative glycosyl transferase
Gene
Gene (GenBank)aknS
EC number
Keyword
Note
Note (GenBank)
  • AknS
Reference
ACC
PmId
[11016846] A gene cluster from Streptomyces galilaeus involved in glycosylation of aclarubicin. (Mol Gen Genet. , 2000)
[15911373] AknT is an activating protein for the glycosyltransferase AknS in L-aminodeoxysugar transfer to the aglycone of aclacinomycin A. (Chem Biol. , 2005)
[17685523] Characterization of rhodosaminyl transfer by the AknS/AknT glycosylation complex and its use in reconstituting the biosynthetic pathway of aclacinomycin A. (J Am Chem Soc. , 2007)
Related Reference
ACC
Q2PZR4
NITE
Cosmo_00120
PmId
[16810496] Insights in the glycosylation steps during biosynthesis of the antitumor anthracycline cosmomycin: characterization of two glycosyltransferase genes. (Appl Microbiol Biotechnol. , 2006)

close this sectionSequence

selected fasta
>dTDP-L-rhodosamine glycosyltransferase [putative glycosyl transferase]
MRVLLTSFALDAHFNGSVPLAWALRAAGHEVRVASQPALTASITAAGLTAVPVGADPRLD
EMVKGVGDAVLSHHADQSLDADTPGQLTPAFLQGWDTMMTATFYTLINDDPMVDDLVAFA
RGWEPDLILWEPFTFAGAVAAKVTGAAHARLLSFPDLFMSMRRAYLAQLGAAPAGPAGGN
GTTHPDDSLGQWLEWTLGRYGVPFDEEAVTGQWSVDQVPRSFRPPSDRPVVGMRYVPYNG
PGPAVVPDWLRVPPTRPRVCVTLGMTARTSEFPNAVPVDLVLKAVEGLDIEVVATLDAEE
RALLTHVPDNVRLVDHVPLHALLPTCAAIVHHGGAGTWSTALVEGVPQIAMGWIWDAIDR
AQRQQALGAGLHLPSHEVTVEGLRGRLVRLLDEPSFTAAAARLRAEAESEPTPAQVVPVL
ERLTAQHRAREPRRPGGTSPCVS
selected fasta
>dTDP-L-rhodosamine glycosyltransferase [putative glycosyl transferase]
ATGCGGGTTCTCCTGACATCCTTCGCGCTGGACGCTCACTTCAACGGGTCCGTGCCGCTG
GCCTGGGCGTTGCGGGCCGCCGGGCACGAGGTGCGGGTGGCGAGCCAGCCCGCGCTGACG
GCGAGCATCACGGCGGCCGGGCTGACCGCCGTGCCGGTGGGCGCGGACCCCCGGCTGGAC
GAGATGGTCAAGGGCGTGGGCGACGCTGTGCTGTCCCACCACGCCGACCAGTCGCTCGAC
GCCGACACCCCCGGACAGCTCACCCCGGCCTTTCTCCAGGGCTGGGACACGATGATGACC
GCCACCTTCTACACCCTGATCAACGACGATCCGATGGTCGACGACCTCGTCGCGTTCGCC
CGCGGCTGGGAACCGGACCTGATCCTGTGGGAGCCGTTCACCTTCGCCGGCGCGGTGGCC
GCGAAGGTGACCGGCGCGGCCCACGCCCGGCTGCTGTCCTTTCCGGACCTCTTCATGTCC
ATGCGGCGGGCCTACCTCGCCCAGCTCGGCGCCGCCCCGGCGGGCCCGGCCGGGGGGAAC
GGGACGACGCACCCCGACGACTCACTCGGCCAGTGGCTGGAGTGGACGCTCGGCCGCTAC
GGCGTCCCCTTCGACGAGGAGGCGGTGACGGGACAGTGGTCGGTGGACCAGGTGCCGCGC
AGCTTCCGCCCGCCGTCGGACCGCCCGGTCGTGGGCATGCGCTACGTCCCCTACAACGGG
CCGGGGCCTGCCGTCGTACCCGACTGGCTGCGCGTCCCGCCGACCCGCCCCCGCGTCTGC
GTCACCCTGGGCATGACGGCCCGGACCTCGGAGTTCCCCAACGCCGTCCCGGTCGACCTC
GTCCTCAAGGCGGTCGAGGGGCTGGACATCGAGGTGGTCGCCACCCTCGACGCCGAGGAA
CGGGCACTGCTGACCCATGTCCCCGACAATGTGCGTCTGGTGGACCATGTGCCGCTGCAC
GCGCTGCTGCCGACCTGCGCGGCCATCGTCCACCACGGCGGCGCCGGCACCTGGTCGACG
GCGCTGGTCGAGGGTGTGCCGCAGATCGCCATGGGCTGGATCTGGGACGCGATCGACCGC
GCGCAGCGTCAGCAGGCACTCGGCGCGGGCCTCCATCTCCCCTCGCACGAGGTGACGGTG
GAGGGACTGCGCGGCAGGCTCGTCCGGCTCCTCGACGAGCCCTCGTTCACCGCGGCGGCC
GCCCGCCTGCGGGCCGAGGCCGAGTCCGAACCGACCCCGGCGCAGGTCGTCCCCGTACTG
GAACGGCTGACCGCCCAGCACCGCGCCCGTGAACCCCGACGCCCCGGAGGTACGTCGCCA
TGCGTGTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [3-98]  4.40000000000001e-13 PF03033
PF03033   Glyco_transf_28
IPR010610 Domain of unknown function DUF1205 (Domain)
 [215-312]  7.89999999999997e-33 PF06722
PF06722   DUF1205
SignalP
 [1-23]  0.926 Signal
Eukaryota   
 [1-23]  0.276 Signal
Bacteria, Gram-positive   
TMHMM No significant hit