close all open/close all

CDS information : Acla_00220


close this sectionLocation

Organism
StrainATCC 31615
Entry nameAclacinomycin A
Contig
Start / Stop / Direction25,774 / 24,443 / - [in whole cluster]
9,619 / 8,288 / - [in contig]
Locationcomplement(24443..25774) [in whole cluster]
complement(8288..9619) [in contig]
TypeCDS
Length1,332 bp (443 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productglycosyltransferase helper protein
Product (GenBank)AknT
Gene
Gene (GenBank)aknT
EC number
Keyword
  • L-rhodosamine
Note
Note (GenBank)
  • may participate in glycosylation of aclacinomycins; similar to DnmQ
Reference
ACC
PmId
[11016846] A gene cluster from Streptomyces galilaeus involved in glycosylation of aclarubicin. (Mol Gen Genet. , 2000)
[15911373] AknT is an activating protein for the glycosyltransferase AknS in L-aminodeoxysugar transfer to the aglycone of aclacinomycin A. (Chem Biol. , 2005)
[17685523] Characterization of rhodosaminyl transfer by the AknS/AknT glycosylation complex and its use in reconstituting the biosynthetic pathway of aclacinomycin A. (J Am Chem Soc. , 2007)
Related Reference
ACC
Q2PZR5
NITE
Cosmo_00110
PmId
[16810496] Insights in the glycosylation steps during biosynthesis of the antitumor anthracycline cosmomycin: characterization of two glycosyltransferase genes. (Appl Microbiol Biotechnol. , 2006)

close this sectionSequence

selected fasta
>glycosyltransferase helper protein [AknT]
MQTQNAPETAENQQTDSELGRHLLTARGFHWIYGTSGDPYALTLRAESDDPALLTRRIRE
AGTPLWQSTTGAWVTGRHGVAAEALADPRLALRHADLPGPQRHVFSDAWSNPQLCHIIPL
DRAFLHASDADHTRWARSASAVLGSAGGAPAEGVREHAGRVHREAADRTGDSFDLMADYS
RPVATEAAAELLGVPAAQRERFAATCLALGVALDAALCPQPLAVTRRLTEAVEDVRALVG
DLVEARRTQPGDDLLSAVLHAGSSAASAGQDALAVGVLTAVVGVEVTAGLINNTLESLLT
RPVQWARLGENPELAAGAVEEALRFAPPVRLESRIAAEDLTLGGQDLPAGAQVVVHVGAA
NRDPEAFLAPDHFDLDRPAGQGQLSLSGPHTALFGAFARLQAETAVRTLRERRPVLAPAG
AVLRRMRSPVLGAVLRFPLTTSA
selected fasta
>glycosyltransferase helper protein [AknT]
GTGCAGACACAGAACGCGCCGGAGACGGCGGAGAACCAGCAGACCGACAGCGAACTGGGC
CGTCATCTCCTGACCGCCCGCGGCTTCCACTGGATCTACGGCACCAGCGGCGACCCGTAC
GCCCTGACCCTGCGCGCCGAGAGCGACGACCCCGCGCTGCTGACCCGCCGGATACGGGAA
GCCGGGACGCCGCTGTGGCAGAGCACCACCGGCGCCTGGGTCACCGGCCGGCACGGCGTC
GCCGCCGAGGCCCTGGCCGATCCCCGGCTCGCCCTGCGCCACGCCGACCTGCCGGGCCCG
CAGCGGCACGTCTTCTCCGACGCCTGGAGCAATCCGCAGCTGTGCCACATCATCCCGCTG
GACCGGGCCTTCCTCCACGCGTCGGACGCCGACCACACGCGCTGGGCGCGGTCCGCCTCC
GCCGTCCTGGGCAGTGCGGGCGGCGCCCCGGCGGAGGGTGTCCGCGAGCACGCCGGGCGC
GTGCACCGGGAGGCCGCCGACCGTACCGGGGACAGCTTCGACCTCATGGCGGACTACTCC
CGCCCGGTGGCCACGGAGGCCGCCGCGGAGCTGCTCGGTGTCCCCGCCGCCCAGCGGGAA
CGCTTCGCGGCGACGTGCCTCGCCCTCGGTGTCGCCCTCGACGCCGCGCTCTGCCCCCAG
CCGCTCGCCGTGACCCGCCGGCTCACCGAGGCCGTCGAGGACGTACGGGCCCTCGTCGGC
GACCTCGTCGAGGCGCGGCGGACGCAGCCGGGTGACGACCTGCTCAGCGCGGTGCTGCAC
GCCGGCTCCTCCGCCGCCTCCGCCGGGCAGGACGCGCTCGCCGTGGGTGTGCTGACCGCC
GTGGTCGGCGTCGAGGTCACCGCCGGGCTCATCAACAACACCCTGGAGTCGCTGCTCACC
CGTCCCGTGCAGTGGGCGCGGCTCGGCGAGAACCCTGAACTCGCGGCCGGCGCCGTGGAG
GAGGCACTGCGCTTCGCGCCGCCGGTGCGGCTGGAGAGCCGTATCGCCGCCGAGGACCTC
ACCCTGGGCGGCCAGGACCTCCCGGCCGGCGCCCAGGTCGTCGTCCATGTCGGTGCGGCG
AACCGGGACCCCGAGGCGTTCCTGGCCCCGGACCACTTCGACCTCGACCGTCCCGCCGGG
CAGGGGCAGTTGTCGCTCTCCGGCCCGCACACCGCGCTCTTCGGGGCGTTCGCCCGGCTC
CAGGCGGAGACCGCGGTCCGCACGCTGCGGGAGCGCCGGCCCGTGCTCGCGCCGGCCGGC
GCGGTCCTGCGGCGGATGCGTTCCCCCGTGCTGGGCGCGGTGCTGCGCTTCCCCCTGACC
ACCTCCGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [317-378]  7e-12 PF00067
PF00067   p450
 [28-441]  5.09998762524166e-51 SSF48264
SSF48264   Cytochrome_P450
 [42-440]  4.30000000000003e-55 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
IPR002397 Cytochrome P450, B-class (Family)
 [174-190]  6.29998179434732e-33 PR00359 [191-206]  6.29998179434732e-33 PR00359 [237-259]  6.29998179434732e-33 PR00359 [317-328]  6.29998179434732e-33 PR00359 [334-361]  6.29998179434732e-33 PR00359 [362-377]  6.29998179434732e-33 PR00359
PR00359   BP450
SignalP No significant hit
TMHMM No significant hit