close all open/close all

CDS information : Acla_00230


close this sectionLocation

Organism
StrainATCC 31615
Entry nameAclacinomycin A
Contig
Start / Stop / Direction26,601 / 25,798 / - [in whole cluster]
10,446 / 9,643 / - [in contig]
Locationcomplement(25798..26601) [in whole cluster]
complement(9643..10446) [in contig]
TypeCDS
Length804 bp (267 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative aklaviketone C-7 ketoreductase
Product (GenBank)putative aklaviketone reductase
Gene
Gene (GenBank)aknU
EC number
Keyword
Note
Note (GenBank)
  • AknU
Reference
ACC
PmId
[11016846] A gene cluster from Streptomyces galilaeus involved in glycosylation of aclarubicin. (Mol Gen Genet. , 2000)
Related Reference
ACC
Q53882
NITE
Dauno_00060
PmId
[8655529] Cloning, sequencing, and analysis of aklaviketone reductase from Streptomyces sp. strain C5. (J Bacteriol. , 1996)

close this sectionSequence

selected fasta
>putative aklaviketone C-7 ketoreductase [putative aklaviketone reductase]
MNRAARPTVRGMSAIAEPTAPRGVIVTGGGTGIGRATAHAFADRGDRVLVVGRTAATLAG
TAEGHPGISVLTADLTDPDGPRAITDAALDALGRIDVLVNNAATGGFAGLAETEPEAARE
QFDSNLLAPLLLTRQTLDALSADGGGTVLNIGSAGALGRRAWPQNGVYGAAKAGLDFLTR
TWAVELAPRGIRVLGLAPGVIDTGIGERSGMSREAYAGFLGQIAARVPAGRVGRPEDIAW
WAVQLADPRAAYATGAVLAVDGGLSLT
selected fasta
>putative aklaviketone C-7 ketoreductase [putative aklaviketone reductase]
GTGAATCGAGCGGCCCGGCCTACGGTCCGGGGCATGAGCGCCATAGCAGAACCGACAGCG
CCGCGGGGCGTGATCGTCACCGGCGGCGGGACCGGGATCGGGCGGGCCACGGCCCACGCC
TTCGCCGACCGCGGCGACCGGGTACTCGTCGTAGGCCGCACCGCCGCGACCCTGGCCGGG
ACCGCCGAGGGCCACCCCGGCATCAGTGTCCTGACCGCCGATCTCACCGATCCGGACGGT
CCGCGCGCCATCACCGACGCGGCGCTGGACGCGTTGGGCCGTATCGACGTCCTCGTGAAC
AACGCGGCCACCGGTGGGTTCGCCGGCCTGGCGGAGACCGAGCCGGAGGCCGCCCGCGAG
CAGTTCGACAGCAACCTCCTGGCCCCGCTGCTGCTCACCCGGCAGACCCTGGACGCCCTG
TCGGCCGACGGCGGGGGAACCGTGCTGAACATCGGCTCGGCCGGAGCTCTGGGCCGCCGG
GCCTGGCCGCAGAACGGTGTCTACGGCGCCGCCAAGGCCGGGCTCGACTTCCTCACCCGG
ACCTGGGCCGTCGAACTGGCACCCCGCGGCATCCGTGTCCTCGGCCTGGCGCCCGGCGTG
ATCGACACCGGCATCGGTGAACGCTCGGGCATGTCACGGGAGGCCTACGCGGGCTTCCTC
GGGCAGATCGCCGCCCGCGTCCCGGCCGGCCGGGTCGGCCGGCCCGAGGACATCGCCTGG
TGGGCCGTCCAGCTGGCCGACCCGCGCGCCGCTTACGCGACCGGAGCGGTGCTCGCGGTC
GACGGCGGTCTGTCCCTCACCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [93-104]  1.09999909120787e-09 PR00080 [146-154]  1.09999909120787e-09 PR00080 [168-187]  1.09999909120787e-09 PR00080
PR00080   SDRFAMILY
 [24-186]  7.7e-25 PF00106
PF00106   adh_short
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [23-40]  6.29998179434732e-34 PR00081 [93-104]  6.29998179434732e-34 PR00081 [140-156]  6.29998179434732e-34 PR00081 [168-187]  6.29998179434732e-34 PR00081 [189-206]  6.29998179434732e-34 PR00081 [228-248]  6.29998179434732e-34 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [22-266]  1.29999999999998e-69 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit