close all open/close all

CDS information : Acla_00240


close this sectionLocation

Organism
StrainATCC 31615
Entry nameAclacinomycin A
Contig
Start / Stop / Direction27,061 / 26,627 / - [in whole cluster]
10,906 / 10,472 / - [in contig]
Locationcomplement(26627..27061) [in whole cluster]
complement(10472..10906) [in contig]
TypeCDS
Length435 bp (144 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)AknV
Gene
Gene (GenBank)aknV
EC number
Keyword
Note
Note (GenBank)
  • may participate in glycosylation of aclacinomycins; similar to DnmW
Reference
ACC
PmId
[11016846] A gene cluster from Streptomyces galilaeus involved in glycosylation of aclarubicin. (Mol Gen Genet. , 2000)
Related Reference
ACC
Q2PA04
NITE
Stref_00110
PmId
[16751529] Isolation, characterization, and heterologous expression of the biosynthesis gene cluster for the antitumor anthracycline steffimycin. (Appl Environ Microbiol. , 2006)
ACC
Q9ZAT9
NITE
Adria_00050
PmId
[9864344] Doxorubicin overproduction in Streptomyces peucetius: cloning and characterization of the dnrU ketoreductase and dnrV genes and the doxA cytochrome P-450 hydroxylase gene. (J Bacteriol. , 1999)
[10631513] A two-plasmid system for the glycosylation of polyketide antibiotics: bioconversion of epsilon-rhodomycinone to rhodomycin D. (Chem Biol. , 1999)
ACC
Q53925
NITE
Actino_00020
PmId
[17227452] Possible involvement of ActVI-ORFA in transcriptional regulation of actVI tailoring-step genes for actinorhodin biosynthesis. (FEMS Microbiol Lett. , 2007)

close this sectionSequence

selected fasta
>hypothetical protein [AknV]
MTAQAPTAPADVYAEVQHFYARQMRYLDSGEAETWAGTFTEDGSFAPPSLPEPVRGRPLL
AEGARNAAAGLAAARETHRHWVGMLTVTPADDGSLTAESLVSIVAVAQGGPARLHLVCTC
RDVLVREGGRLLVRERVVTRDDRP
selected fasta
>hypothetical protein [AknV]
ATGACAGCACAGGCACCGACGGCCCCGGCGGACGTCTACGCCGAGGTACAGCATTTCTAC
GCACGGCAGATGCGGTACCTGGACTCGGGCGAGGCCGAGACCTGGGCCGGCACCTTCACC
GAGGACGGCTCCTTCGCACCGCCCTCGCTCCCGGAGCCGGTACGCGGACGCCCGCTGCTC
GCCGAGGGTGCCCGCAACGCCGCGGCGGGTCTGGCCGCCGCCCGCGAGACGCACCGCCAC
TGGGTCGGCATGCTCACCGTCACCCCCGCGGACGACGGCTCGCTGACCGCCGAGAGCCTG
GTCTCGATCGTCGCCGTCGCGCAGGGCGGCCCCGCCCGGCTGCACCTGGTCTGCACCTGC
CGGGACGTCCTGGTCCGGGAGGGCGGCCGGCTCCTGGTCCGGGAACGCGTGGTGACCCGT
GACGACCGGCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit