close all open/close all

CDS information : Acla_00250


close this sectionLocation

Organism
StrainATCC 31615
Entry nameAclacinomycin A
Contig
Start / Stop / Direction27,271 / 28,050 / + [in whole cluster]
11,116 / 11,895 / + [in contig]
Location27271..28050 [in whole cluster]
11116..11895 [in contig]
TypeCDS
Length780 bp (259 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productcyclase
Product (GenBank)putative cyclase
Gene
Gene (GenBank)aknW
EC number
Keyword
  • 2nd and 3rd ring
Note
Note (GenBank)
  • AknW
Reference
ACC
PmId
[11016846] A gene cluster from Streptomyces galilaeus involved in glycosylation of aclarubicin. (Mol Gen Genet. , 2000)
[12715874] Studies on a second and third ring cyclization in anthracycline biosynthesis. (J Antibiot (Tokyo). , 2003)
Related Reference
ACC
Q9RN54
NITE
Nogl_00250
PmId
[11683270] The entire nogalamycin biosynthetic gene cluster of Streptomyces nogalater: characterization of a 20-kb DNA region and generation of hybrid structures. (Mol Genet Genomics. , 2001)
[12715874] Studies on a second and third ring cyclization in anthracycline biosynthesis. (J Antibiot (Tokyo). , 2003)
ACC
O68500
NITE
Adria_00160
PmId
[9573189] The Streptomyces peucetius dpsY and dnrX genes govern early and late steps of daunorubicin and doxorubicin biosynthesis. (J Bacteriol. , 1998)
[10419974] The Streptomyces peucetius dpsC gene determines the choice of starter unit in biosynthesis of the daunorubicin polyketide. (J Bacteriol. , 1999)

close this sectionSequence

selected fasta
>cyclase [putative cyclase]
MRIIDLSSPVDAAGFEPDPVVHDVLGPKEAATHMSEEMREHFGIDFDPAELPEGEFLSLD
RLQLTTHTGTHVDAPSHYGTRAAYRDGPPRHIDEMPLDWFFRPAVVLDLSDQGTGAVGAD
VLRREMDRIGHTPSPMDIVLLRTGADAWAGTPKYFTDFTGLDGSAVHLLLDLGVRVIGTD
AFSLDAPFGDIITRYRATGDPSVLWPAHVIGRDREYCQVERLAGLDRLPAAHGFRVACFP
VRIAGAGAGWTRAVALVDE
selected fasta
>cyclase [putative cyclase]
GTGCGCATCATCGACCTGTCCTCACCCGTGGACGCGGCGGGTTTTGAACCTGATCCCGTC
GTGCACGACGTTCTCGGTCCGAAGGAGGCCGCCACGCACATGAGCGAGGAGATGCGTGAG
CACTTCGGCATCGACTTCGATCCGGCGGAACTGCCGGAGGGCGAATTCCTCTCGCTCGAC
CGTCTCCAGCTGACCACCCACACCGGAACCCATGTCGACGCGCCCTCGCACTACGGCACG
CGCGCCGCGTACCGGGACGGTCCGCCGCGGCACATCGACGAGATGCCGCTCGACTGGTTC
TTCCGGCCCGCCGTCGTCCTCGACCTCAGCGACCAGGGCACGGGCGCGGTCGGCGCCGAC
GTGCTGCGGCGGGAGATGGACCGGATCGGCCACACTCCCTCGCCCATGGACATCGTCCTG
CTCAGGACCGGTGCCGACGCGTGGGCGGGAACCCCGAAGTACTTCACGGACTTCACCGGG
CTGGACGGTTCGGCCGTGCACCTGCTGCTGGACCTGGGGGTGCGGGTGATCGGCACGGAC
GCGTTCAGCCTGGACGCGCCGTTCGGCGACATCATCACCCGCTACCGGGCCACGGGCGAC
CCGTCGGTCCTGTGGCCCGCCCATGTCATCGGGCGGGACCGGGAGTACTGCCAGGTCGAG
CGGCTCGCCGGGCTCGACCGGCTGCCCGCCGCGCACGGGTTCCGGGTCGCGTGCTTCCCG
GTGCGGATCGCCGGAGCGGGCGCCGGCTGGACGAGGGCGGTGGCCCTGGTCGACGAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007325 Putative cyclase (Family)
 [3-187]  7.00000000000005e-40 PF04199
PF04199   Cyclase
SignalP No significant hit
TMHMM No significant hit