close all open/close all

CDS information : Acla_00260


close this sectionLocation

Organism
StrainATCC 31615
Entry nameAclacinomycin A
Contig
Start / Stop / Direction28,112 / 28,828 / + [in whole cluster]
11,957 / 12,673 / + [in contig]
Location28112..28828 [in whole cluster]
11957..12673 [in contig]
TypeCDS
Length717 bp (238 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose N,N-dimethyltransferase
Product (GenBank)putative aminomethylase
Gene
Gene (GenBank)aknX2
EC number2.1.1.-
Keyword
  • L-rhodosamine
Note
Note (GenBank)
  • AknX2
Reference
ACC
PmId
[11016846] A gene cluster from Streptomyces galilaeus involved in glycosylation of aclarubicin. (Mol Gen Genet. , 2000)
[12427929] Characterization of mutations in aclacinomycin A-non-producing Streptomyces galilaeus strains with altered glycosylation patterns. (Microbiology. , 2002)
Related Reference
ACC
Q9ZGH6
NITE
Pikro_00100
PmId
[9770448] A gene cluster for macrolide antibiotic biosynthesis in Streptomyces venezuelae: architecture of metabolic diversity. (Proc Natl Acad Sci U S A. , 1998)
[12119032] Expression, purification, and characterization of two N,N-dimethyltransferases, tylM1 and desVI, involved in the biosynthesis of mycaminose and desosamine. (Biochemistry. , 2002)

close this sectionSequence

selected fasta
>putative NDP-hexose N,N-dimethyltransferase [putative aminomethylase]
MYGRELADVYEAIYRSRGKDWGQEAADVSRIITERRPGAGSLLDVACGTGAHLSVFSTLF
EVAEGLEIAEPMRRLAEQRLPGTTVHAGDMRDFRLPRTYDAVSCMFCAIGYLETLDDMRA
AVRSMAAHLEPGGVLVVEPWWFPENFIEGYVAGDLAREEHRTIARISHTTRKGRATRMEV
RFTVGDAAGIQQFTEIDVLTLFTRDEYTAAFTDAGCSVEFLEDGPTGRGLFVGVREQR
selected fasta
>putative NDP-hexose N,N-dimethyltransferase [putative aminomethylase]
ATGTACGGCCGGGAACTCGCGGACGTGTACGAGGCCATCTACCGCAGCCGCGGCAAGGAC
TGGGGACAGGAGGCGGCGGACGTCTCGCGGATCATCACCGAACGGCGTCCGGGAGCCGGC
TCGCTGCTCGACGTCGCCTGTGGCACGGGCGCCCATCTGAGCGTGTTCAGCACGCTGTTC
GAGGTCGCCGAGGGCCTGGAGATCGCGGAGCCGATGCGGCGGCTCGCCGAGCAGCGGCTG
CCCGGCACCACCGTGCACGCCGGCGACATGCGCGACTTCCGGCTCCCGCGCACCTACGAC
GCGGTGAGCTGCATGTTCTGCGCCATCGGCTATCTGGAGACGCTGGACGACATGCGGGCC
GCCGTCCGGTCGATGGCCGCTCATCTGGAGCCCGGCGGCGTGCTGGTCGTCGAACCCTGG
TGGTTCCCCGAGAACTTCATCGAGGGCTATGTCGCGGGTGACCTGGCCCGCGAGGAGCAC
CGGACCATCGCCCGGATCTCGCACACCACCCGGAAGGGCCGGGCCACCCGCATGGAGGTT
CGCTTCACCGTGGGGGACGCCGCCGGCATCCAGCAGTTCACGGAGATCGACGTGCTGACC
CTGTTCACCAGGGACGAATACACCGCCGCGTTCACCGACGCCGGCTGTTCCGTTGAATTC
CTGGAGGACGGACCCACCGGCCGCGGTCTTTTCGTCGGTGTTCGCGAACAGCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit