close all open/close all

CDS information : Acla_00270


close this sectionLocation

Organism
StrainATCC 31615
Entry nameAclacinomycin A
Contig
Start / Stop / Direction29,716 / 28,841 / - [in whole cluster]
13,561 / 12,686 / - [in contig]
Locationcomplement(28841..29716) [in whole cluster]
complement(12686..13561) [in contig]
TypeCDS
Length876 bp (291 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative glucose-1-phosphate thymidylyltransferase
putative dTDP-glucose synthase
Product (GenBank)putative dTDP-1-glucose synthase
Gene
Gene (GenBank)aknY
EC number2.7.7.24
Keyword
  • L-rhodosamine
  • L-2-deoxyfucose
  • L-rhodinose
Note
Note (GenBank)
  • AknY
Reference
ACC
PmId
[11016846] A gene cluster from Streptomyces galilaeus involved in glycosylation of aclarubicin. (Mol Gen Genet. , 2000)
[12427929] Characterization of mutations in aclacinomycin A-non-producing Streptomyces galilaeus strains with altered glycosylation patterns. (Microbiology. , 2002)
Related Reference
ACC
Q9AGY4
PmId
[12147463] Homologs of the Rml enzymes from Salmonella enterica are responsible for dTDP-beta-L-rhamnose biosynthesis in the gram-positive thermophile Aneurinibacillus thermoaerophilus DSM 10155. (Appl Environ Microbiol. , 2002)

close this sectionSequence

selected fasta
>putative glucose-1-phosphate thymidylyltransferase [putative dTDP-1-glucose synthase]
MKGIILAGGSGTRLHPITVSVSKQLLPVGDKPMIYYPLSVLMLADIREILLICTERDLEQ
FRRLLGDGSQLGLRIDYAVQNRPAGLADAFVIGADHVGDDDVALVLGDNIFHGHHFYDLL
QSNVHDVQGCVLFGYPVEDPERYGVGETDASGQLVSLEEKPLRPRSDLAITGLYLYDNEV
VDIAKNLRPSPRGELEITDVNRNYLARGRARLVDLGRGFAWLDAGTPESLLQATQYVRTL
EERQGVRIACVEEVALRMGFIDADMCHRLGEQMSQSGYGRYVMAVAREFSG
selected fasta
>putative glucose-1-phosphate thymidylyltransferase [putative dTDP-1-glucose synthase]
ATGAAGGGGATTATTCTCGCCGGCGGTTCGGGAACACGGCTCCATCCGATAACCGTCTCC
GTATCAAAACAGCTTCTTCCGGTCGGCGACAAGCCGATGATCTACTATCCGCTCTCGGTG
CTGATGCTGGCGGACATCAGGGAGATCCTGCTCATCTGCACCGAGCGCGATCTGGAACAG
TTCCGCCGGCTCCTGGGCGACGGCTCCCAGCTCGGCCTGCGCATCGACTACGCGGTGCAG
AACCGGCCGGCCGGACTGGCCGACGCCTTCGTCATCGGCGCCGACCACGTGGGTGACGAC
GACGTGGCACTGGTCCTCGGGGACAACATCTTCCACGGACACCACTTCTACGACCTGCTC
CAGAGCAACGTCCACGACGTCCAGGGCTGCGTGCTGTTCGGCTACCCCGTGGAGGACCCG
GAGCGCTACGGCGTGGGCGAGACCGACGCGTCGGGGCAACTCGTCTCCCTGGAGGAGAAG
CCGCTCCGGCCGCGTTCCGACCTCGCCATCACCGGGCTCTATCTGTACGACAACGAAGTG
GTGGACATCGCGAAGAACCTCCGGCCCTCGCCGCGCGGCGAACTGGAGATCACCGATGTG
AACCGGAATTACCTGGCCCGCGGCCGAGCGCGTCTGGTCGATCTCGGCCGCGGTTTCGCC
TGGCTCGACGCCGGAACCCCGGAATCGCTGCTTCAGGCCACCCAGTACGTGCGCACGCTC
GAAGAACGGCAGGGCGTGCGCATCGCCTGCGTCGAAGAAGTGGCGCTGCGCATGGGATTC
ATCGACGCGGACATGTGCCACCGACTCGGTGAGCAGATGTCGCAGTCCGGTTACGGTCGC
TATGTGATGGCGGTCGCCCGAGAATTCTCGGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005835 Nucleotidyl transferase (Domain)
 [2-237]  3.40000000000004e-63 PF00483
PF00483   NTP_transferase
IPR005907 Glucose-1-phosphate thymidylyltransferase, short form (Family)
 [2-286]  1.39999999999997e-128 TIGR01207
TIGR01207   RmlA
SignalP No significant hit
TMHMM No significant hit