close all open/close all
Acla_00270 Acla_00270   last last

CDS information : Acla_00280


close this sectionLocation

Organism
StrainATCC 31615
Entry nameAclacinomycin A
Contig
Start / Stop / Direction29,939 / 30,962 / + [in whole cluster]
13,784 / 14,807 / + [in contig]
Location29939..30962 [in whole cluster]
13784..14807 [in contig]
TypeCDS
Length1,024 bp (340 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-3 aminotransferase(fragment)
Product (GenBank)putative aminotransferase
Gene
Gene (GenBank)aknZ
EC number
Keyword
  • L-rhodosamine
Note
Note (GenBank)
  • AknZ
Reference
ACC
PmId
[11016846] A gene cluster from Streptomyces galilaeus involved in glycosylation of aclarubicin. (Mol Gen Genet. , 2000)
[12427929] Characterization of mutations in aclacinomycin A-non-producing Streptomyces galilaeus strains with altered glycosylation patterns. (Microbiology. , 2002)
Related Reference
ACC
Q9F837
NITE
Megalo_00050
PmId
[16514147] In vivo characterization of the dTDP-D-desosamine pathway of the megalomicin gene cluster from Micromonospora megalomicea. (Microbiology. , 2006)
[20418422] TDP-L-megosamine biosynthesis pathway elucidation and megalomicin a production in Escherichia coli. (Appl Environ Microbiol. , 2010)

close this sectionSequence

selected fasta
>putative NDP-hexose C-3 aminotransferase(fragment) [putative aminotransferase]
MTTLVWDYLQEYENERADILDAVETVFSSGRLVLGDSVRGFEEEFAAYHGAAHCVGVDNG
TNAIKLALQALGVGPGDEVVTVSNTAAPTVVAIDSVGATPVFVDVHPDSYLMDTEQVEAA
LTPRTRCLLPVHLYGQCVDLAPLERLAAEHDLFLVEDCAQAHGARRAGRLAGTTGDAAAF
SFYPTKVLGAYGDGGAVVTSRDDTHRALRRLRYYGMEERYYVVGTPGHNARLDEVQAEIL
RRKLRRLDTYIEGRRAVARRYEDGLGDTGLVLPHTVPGNEHVYYVYTVRHPRRDDIIKAL
KAYDIELNISYPWPVHTMSGFAHLGYGKGSLPVTEDLAGQI-
selected fasta
>putative NDP-hexose C-3 aminotransferase(fragment) [putative aminotransferase]
ATGACGACTCTCGTCTGGGACTACCTACAGGAATACGAGAACGAACGCGCCGACATTCTG
GACGCCGTGGAGACGGTCTTCAGCTCGGGTCGGCTCGTCCTCGGTGACAGCGTTCGCGGA
TTCGAGGAGGAGTTCGCCGCGTACCACGGCGCGGCGCACTGCGTCGGTGTCGACAACGGC
ACCAACGCGATCAAGCTGGCCCTCCAGGCGCTCGGCGTCGGCCCCGGTGACGAGGTCGTC
ACGGTGTCCAACACCGCGGCCCCCACGGTCGTGGCCATCGATTCGGTGGGCGCCACCCCG
GTGTTCGTCGACGTCCACCCGGACAGCTACCTCATGGACACCGAGCAGGTGGAGGCCGCA
CTCACGCCCCGGACCCGATGCCTGCTGCCGGTCCATCTCTACGGGCAGTGCGTCGACCTG
GCTCCGCTGGAGCGGCTCGCCGCGGAGCACGACCTGTTCCTCGTCGAGGACTGCGCACAG
GCCCACGGTGCCCGCCGCGCCGGCCGGCTCGCCGGCACCACCGGCGACGCCGCCGCCTTC
TCCTTCTACCCCACGAAGGTGCTCGGCGCCTACGGCGACGGAGGCGCCGTGGTGACCTCC
CGGGACGACACCCACCGCGCGCTGCGCCGACTGCGCTACTACGGCATGGAGGAGCGGTAC
TACGTCGTCGGCACCCCGGGTCACAACGCCCGGCTCGACGAGGTCCAGGCCGAGATCCTG
CGGCGCAAGCTGCGCCGGCTCGACACCTACATCGAGGGGCGGCGGGCCGTCGCCCGGCGC
TACGAGGACGGGCTCGGCGACACCGGCCTGGTGCTCCCGCACACCGTCCCCGGCAACGAG
CACGTGTACTACGTCTACACGGTGCGCCACCCGCGGCGCGACGACATCATCAAGGCCCTC
AAGGCGTACGACATCGAGCTGAACATCAGCTATCCCTGGCCCGTGCACACCATGTCCGGG
TTCGCCCACCTCGGCTACGGCAAGGGCTCGCTGCCCGTCACCGAGGACCTGGCCGGCCAG
ATCT

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000653 DegT/DnrJ/EryC1/StrS aminotransferase (Family)
 [15-340]  1.6e-110 PF01041
PF01041   DegT_DnrJ_EryC1
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (Domain)
 [16-246]  9.5e-77 G3DSA:3.40.640.10
G3DSA:3.40.640.10   no description
IPR015422 Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (Domain)
 [247-341]  2.5e-23 G3DSA:3.90.1150.10
G3DSA:3.90.1150.10   no description
IPR015424 Pyridoxal phosphate-dependent transferase, major domain (Domain)
 [16-341]  2.7e-96 SSF53383
SSF53383   PLP-dependent transferases
SignalP No significant hit
TMHMM No significant hit
Acla_00270 Acla_00270   last last