close all open/close all
first first   Actino_00020 Actino_00020

CDS information : Actino_00010


close this sectionLocation

Organism
StrainA3(2) (=NBRC 15146)
Entry nameActinorhodin
Contig
Start / Stop / Direction1,213 / 29 / - [in whole cluster]
1,213 / 29 / - [in contig]
Locationcomplement(29..1213) [in whole cluster]
complement(29..1213) [in contig]
TypeCDS
Length1,185 bp (394 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hydroxylacyl-CoA dehydrogenase
GeneactVI-ORFB
Gene (GenBank)ORFB
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in actinorhodin biosynthesis.
Note (GenBank)
Reference
ACC
PmId
[7929165] DNA sequence and functions of the actVI region of the actinorhodin biosynthetic gene cluster of Streptomyces coelicolor A3(2). (J Biol Chem. , 1994)
[10805574] Chemical characterisation of disruptants of the Streptomyces coelicolor A3(2) actVI genes involved in actinorhodin biosynthesis. (J Antibiot (Tokyo). , 2000)

close this sectionSequence

selected fasta
>hypothetical protein [hydroxylacyl-CoA dehydrogenase]
MLSVGHGPRHVLVVARPHPDEPVGGATALALAELVAGGDRRSPATDPEAVTWDIVLCLDP
DGAALSEGIETATAGPAPSLASYYRAAFRPVAAEQPEWAPIVGRPLPESRALFDVIDDLR
PVLQCSLHNVDAGGTWAQLTRDLPGLAAPFAASAAALGVPVQHGTYDALYWENPAPGIHV
LPPPGSTARPAAGSEDIGLSTWCAPQRYGGATAIVEVPLWATAPADDPTPHADPARALRA
LSGLVREGGRQVTAVFERARGLLPAPEDSPPVRVLEWMAEDLYDLVADSWGPLVRQAEAG
PRTDGSPALTTAGIGALEVVARRQPLRAAGLLLRLLHAADAPAAAGLHHELDALFTAWCT
DFETSLRLRWVPVHAQVELQARTVVAAAECALTP
selected fasta
>hypothetical protein [hydroxylacyl-CoA dehydrogenase]
ATGCTGTCGGTGGGCCACGGACCCCGGCACGTCCTGGTGGTGGCCCGGCCGCACCCGGAC
GAGCCGGTGGGCGGCGCGACGGCACTGGCGCTGGCGGAGCTGGTCGCAGGCGGCGACCGG
CGCTCCCCGGCGACCGACCCCGAGGCCGTCACCTGGGACATCGTCCTGTGCCTCGACCCG
GACGGCGCCGCGCTGAGCGAGGGCATCGAGACCGCGACGGCCGGCCCCGCCCCGTCCCTG
GCGTCGTACTACCGTGCCGCCTTCCGCCCGGTCGCCGCGGAGCAGCCGGAGTGGGCCCCG
ATCGTCGGCCGGCCACTCCCGGAGAGCCGTGCCCTGTTCGACGTGATCGACGACCTGCGC
CCCGTCCTCCAGTGCTCCCTGCACAACGTCGACGCGGGCGGCACCTGGGCCCAGCTGACC
CGCGACCTCCCCGGACTCGCCGCCCCCTTCGCGGCGTCCGCCGCCGCCCTGGGGGTCCCG
GTCCAGCACGGCACGTACGACGCCCTGTACTGGGAGAATCCGGCCCCCGGCATCCATGTC
CTGCCGCCGCCGGGCAGCACCGCGCGGCCGGCGGCCGGGTCCGAGGACATCGGCCTGTCC
ACCTGGTGCGCGCCCCAGCGGTACGGCGGTGCCACGGCGATCGTCGAGGTACCGCTGTGG
GCCACCGCCCCGGCGGACGACCCGACCCCGCACGCGGACCCCGCCCGGGCCCTGCGCGCG
CTGTCCGGGCTGGTGCGGGAGGGCGGCCGGCAGGTGACCGCCGTGTTCGAGAGGGCCCGC
GGCCTCCTGCCGGCACCCGAGGACAGCCCACCCGTACGCGTACTGGAGTGGATGGCCGAG
GACCTGTACGACCTGGTGGCCGACTCCTGGGGGCCCCTGGTCCGGCAGGCGGAGGCGGGA
CCGCGCACCGACGGCTCACCCGCGTTGACGACGGCGGGGATCGGCGCCCTGGAGGTCGTC
GCGCGCCGTCAGCCGCTACGCGCGGCGGGACTCCTGCTGCGGCTGCTGCACGCGGCCGAC
GCCCCGGCCGCCGCCGGGCTCCACCACGAGCTGGACGCCCTCTTCACCGCCTGGTGCACG
GACTTCGAGACGTCCCTGCGGCTGCGCTGGGTCCCCGTGCACGCCCAGGTGGAACTCCAG
GCCCGCACGGTCGTGGCGGCGGCGGAGTGCGCGCTGACACCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit
first first   Actino_00020 Actino_00020