close all open/close all

CDS information : Actino_00020


close this sectionLocation

Organism
StrainA3(2) (=NBRC 15146)
Entry nameActinorhodin
Contig
Start / Stop / Direction2,009 / 1,569 / - [in whole cluster]
2,009 / 1,569 / - [in contig]
Locationcomplement(1569..2009) [in whole cluster]
complement(1569..2009) [in contig]
TypeCDS
Length441 bp (146 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hydroxylacyl-CoA dehydrogenase
GeneactVI-ORFA
Gene (GenBank)ORFA
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[7929165] DNA sequence and functions of the actVI region of the actinorhodin biosynthetic gene cluster of Streptomyces coelicolor A3(2). (J Biol Chem. , 1994)
[17227452] Possible involvement of ActVI-ORFA in transcriptional regulation of actVI tailoring-step genes for actinorhodin biosynthesis. (FEMS Microbiol Lett. , 2007)

close this sectionSequence

selected fasta
>hypothetical protein [hydroxylacyl-CoA dehydrogenase]
MTITALPTGLYAEVLSFYGHQMQKLDGRDFAGYAATFTEDGEFRHSPSLPAAHTRAGITA
VLEDFHRKFDARKIQRRHWFDHTALSQASDGSITATSYCLVLTVHADVKAPEFGPSCLVH
DVLVRGADGELLLRSRHVTHDHVFPA
selected fasta
>hypothetical protein [hydroxylacyl-CoA dehydrogenase]
ATGACCATCACCGCGCTTCCCACCGGCCTGTACGCCGAGGTCCTGTCGTTCTACGGCCAC
CAGATGCAGAAGCTGGACGGCCGTGACTTCGCCGGCTACGCCGCGACCTTCACCGAGGAC
GGCGAGTTCAGGCACTCGCCCTCGCTGCCTGCCGCCCACACCCGTGCCGGGATCACCGCC
GTCCTGGAGGACTTCCACCGCAAGTTCGACGCCCGCAAAATCCAGCGCAGGCACTGGTTC
GACCACACGGCGCTGAGCCAGGCGTCCGACGGCTCGATCACGGCGACCAGCTACTGCCTG
GTGCTCACCGTCCACGCCGACGTCAAGGCGCCGGAGTTCGGGCCGAGTTGCCTCGTGCAC
GACGTCCTGGTCCGGGGGGCGGACGGCGAGTTGCTGCTGCGCTCCCGCCACGTCACCCAT
GACCACGTCTTCCCGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit