close all open/close all

CDS information : Actino_00030


close this sectionLocation

Organism
StrainA3(2) (=NBRC 15146)
Entry nameActinorhodin
Contig
Start / Stop / Direction2,083 / 3,006 / + [in whole cluster]
2,083 / 3,006 / + [in contig]
Location2083..3006 [in whole cluster]
2083..3006 [in contig]
TypeCDS
Length924 bp (307 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
ProductC-3 ketoreductase
Product (GenBank)hydroxylacyl-CoA dehydrogenase
GeneactVI-ORF1
Gene (GenBank)ORF1
EC number
Keyword
  • S-stereochemistry
Note
Note (GenBank)
Reference
ACC
PmId
[7929165] DNA sequence and functions of the actVI region of the actinorhodin biosynthetic gene cluster of Streptomyces coelicolor A3(2). (J Biol Chem. , 1994)
[10091691] Proof that the ACTVI genetic region of Streptomyces coelicolor A3(2) is involved in stereospecific pyran ring formation in the biosynthesis of actinorhodin. (Bioorg Med Chem Lett. , 1999)
[10805574] Chemical characterisation of disruptants of the Streptomyces coelicolor A3(2) actVI genes involved in actinorhodin biosynthesis. (J Antibiot (Tokyo). , 2000)
[15498668] Remarkably different structures and reaction mechanisms of ketoreductases for the opposite stereochemical control in the biosynthesis of BIQ antibiotics. (Bioorg Med Chem. , 2004)
[17579485] Actinorhodin biosynthesis: structural requirements for post-PKS tailoring intermediates revealed by functional analysis of ActVI-ORF1 reductase. (Biochemistry. , 2007)

close this sectionSequence

selected fasta
>C-3 ketoreductase [hydroxylacyl-CoA dehydrogenase]
MSTVTVIGAGTIGLGWINLFSARGLTVRVNSRRPDVRRVVHEALELFSPGRVDELAARIE
YEPDVGRAVAGADVVSENAPDDLPLKQRLFAEIGAAAPDHALVLSSTSKLLPDELSRDMP
GPGRLVVAHPFNPPHIVPLVEVVRGERTDPEAVERTLAFLASVGRTPVVVRRALPGFAAN
RLQSALLRESIHLVLEGVVTVEELDRIVTDSIGLRWSTIGPFHAFHLGGGPGGLRKWLEH
LGSGLEQGWRGLGQPALTPQAVEALVAQTEAAYGHRPYAELVRDRDDRHLAVLAALERTE
QPQEETK
selected fasta
>C-3 ketoreductase [hydroxylacyl-CoA dehydrogenase]
ATGAGCACCGTGACAGTGATCGGGGCGGGCACGATCGGCCTGGGATGGATCAACCTGTTC
AGCGCCCGCGGGCTGACCGTACGCGTCAACAGCCGTCGGCCCGACGTCCGGCGCGTCGTG
CACGAGGCGCTCGAGCTGTTCTCCCCGGGGCGGGTGGACGAGCTGGCGGCGCGCATCGAG
TACGAGCCGGACGTCGGCCGGGCGGTGGCCGGGGCGGACGTCGTCTCCGAGAACGCCCCC
GACGACCTGCCGCTCAAGCAGCGGTTGTTCGCAGAGATCGGAGCGGCCGCCCCGGACCAC
GCCCTCGTGCTGTCCTCGACGTCGAAGCTGCTTCCCGACGAGCTGAGTCGGGACATGCCG
GGACCGGGCCGGCTGGTCGTCGCGCATCCGTTCAACCCACCGCACATCGTTCCGCTGGTC
GAGGTGGTCCGCGGCGAGCGCACCGACCCGGAGGCCGTCGAACGGACACTGGCCTTCCTG
GCGTCGGTCGGGCGGACCCCCGTCGTGGTGCGCAGGGCGCTGCCCGGCTTCGCGGCCAAC
CGGCTGCAGTCGGCGCTGCTGCGCGAGAGCATCCACCTCGTCCTCGAAGGCGTGGTGACC
GTCGAGGAGCTCGACCGGATCGTCACCGACTCGATCGGCCTGCGCTGGTCCACCATCGGG
CCGTTCCACGCGTTCCACCTGGGCGGCGGTCCCGGCGGCCTGCGCAAGTGGCTCGAGCAC
CTCGGCAGCGGCCTCGAACAGGGCTGGCGTGGGCTCGGACAGCCCGCCCTCACCCCGCAG
GCCGTCGAGGCTCTGGTCGCACAGACCGAAGCCGCCTACGGACACCGGCCCTACGCCGAA
CTGGTCCGGGACCGTGACGACCGGCACCTCGCCGTACTGGCCGCCCTGGAGCGGACCGAG
CAGCCCCAGGAGGAGACCAAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006108 3-hydroxyacyl-CoA dehydrogenase, C-terminal (Domain)
 [176-268]  5.2e-13 PF00725
PF00725   3HCDH
IPR006176 3-hydroxyacyl-CoA dehydrogenase, NAD binding (Domain)
 [3-171]  1.5e-44 PF02737
PF02737   3HCDH_N
IPR008927 6-phosphogluconate dehydrogenase, C-terminal-like (Domain)
 [176-264]  1.6e-11 SSF48179
SSF48179   6-phosphogluconate dehydrogenase C-terminal domain-like
IPR013328 Dehydrogenase, multihelical (Domain)
 [178-230]  4.4e-07 G3DSA:1.10.1040.10
G3DSA:1.10.1040.10   no description
IPR016040 NAD(P)-binding domain (Domain)
 [3-177]  2e-36 G3DSA:3.40.50.720
G3DSA:3.40.50.720   no description
SignalP
 [1-33]  0.167 Signal
Bacteria, Gram-positive   
TMHMM
 [5-27]  Transmembrane (o-i)
Transmembrane 1