close all open/close all

CDS information : Actino_00040


close this sectionLocation

Organism
StrainA3(2) (=NBRC 15146)
Entry nameActinorhodin
Contig
Start / Stop / Direction3,003 / 3,992 / + [in whole cluster]
3,003 / 3,992 / + [in contig]
Location3003..3992 [in whole cluster]
3003..3992 [in contig]
TypeCDS
Length990 bp (329 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative oxidoreductase
Product (GenBank)
GeneactVI-ORF2
Gene (GenBank)ORF2
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[7929165] DNA sequence and functions of the actVI region of the actinorhodin biosynthetic gene cluster of Streptomyces coelicolor A3(2). (J Biol Chem. , 1994)
[10805574] Chemical characterisation of disruptants of the Streptomyces coelicolor A3(2) actVI genes involved in actinorhodin biosynthesis. (J Antibiot (Tokyo). , 2000)
Related Reference
ACC
Q8KSX4
NITE
Griseo_00180
PmId
[19175308] Cleavage of four carbon-carbon bonds during biosynthesis of the griseorhodin a spiroketal pharmacophore. (J Am Chem Soc. , 2009)
ACC
Q59I44
PmId
[15781461] 2-Haloacrylate reductase, a novel enzyme of the medium chain dehydrogenase/reductase superfamily that catalyzes the reduction of a carbon-carbon double bond of unsaturated organohalogen compounds. (J Biol Chem. , 2005)

close this sectionSequence

selected fasta
>putative oxidoreductase
MMRAVQFDRYGDPDVLYVAERPVPEPGPGQVRIAVDAVSVGHAQTQMRREAFPAPMWRPV
FPVVLGGDVVGRITAVGPGVTALRPGDRVGAFTLYGAYAEQVVVDAVTVVPVPEELDAAE
AAVLPGTGLIALGILRTGRLRKGETVLIHAAAGGVGHIAVQLARAAGAGLIIGTAGAAAK
REFARATGADAVVDHRSAHWADEVRELTGGRGPDLILDGIGAEVLEQGVGLLAPGGRLVF
YGSSGGELAIPKVSVMDLIGIKYVTGFALSAWRGGRPQEYEAGVAELTRLLAEGQVTSAV
HARLPLERAAEAHAVVEARAQLGRVVLVP
selected fasta
>putative oxidoreductase
GTGATGCGTGCCGTGCAGTTCGACCGGTACGGGGACCCCGACGTGCTGTACGTCGCCGAG
CGTCCCGTCCCCGAACCCGGCCCCGGCCAGGTGAGAATCGCCGTCGACGCCGTGAGCGTC
GGCCACGCGCAGACCCAGATGCGGCGCGAGGCCTTCCCCGCGCCGATGTGGCGGCCCGTC
TTCCCCGTCGTCCTCGGCGGCGACGTGGTCGGCAGGATCACCGCGGTGGGACCGGGCGTC
ACGGCCCTGCGGCCGGGAGACCGGGTCGGTGCGTTCACCCTCTACGGCGCCTACGCCGAG
CAGGTCGTCGTCGACGCCGTCACCGTCGTACCCGTGCCCGAGGAGCTGGACGCCGCCGAG
GCCGCGGTCCTCCCGGGCACCGGACTGATCGCCCTCGGCATCCTGCGGACCGGACGACTG
CGCAAGGGCGAGACGGTGCTGATCCACGCGGCGGCCGGCGGGGTGGGCCACATCGCGGTC
CAGCTCGCCCGGGCGGCCGGCGCCGGCCTGATCATCGGCACCGCGGGCGCGGCCGCCAAA
CGCGAGTTCGCCCGCGCGACGGGCGCCGACGCCGTCGTCGACCACCGCTCCGCACACTGG
GCCGACGAGGTCCGGGAACTCACCGGGGGGCGTGGCCCCGACCTGATCCTGGACGGCATC
GGCGCCGAGGTCCTGGAGCAGGGAGTCGGTCTGCTCGCTCCGGGCGGCCGGCTGGTGTTC
TACGGCTCGTCCGGCGGCGAGCTGGCGATCCCGAAGGTGTCGGTGATGGACCTCATCGGC
ATCAAGTACGTCACCGGCTTCGCCCTGTCGGCCTGGCGCGGTGGCCGCCCGCAGGAGTAC
GAGGCGGGCGTCGCCGAACTCACCCGACTGCTGGCCGAAGGACAGGTCACGTCCGCGGTG
CACGCCCGGCTGCCGCTGGAGCGGGCGGCCGAGGCGCACGCCGTCGTCGAGGCCAGGGCC
CAGCTGGGCCGGGTCGTGCTCGTCCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002364 Quinone oxidoreductase/zeta-crystallin, conserved site (Conserved_site)
 [143-164]  PS01162
PS01162   QOR_ZETA_CRYSTAL
IPR011032 GroES-like (Domain)
 [2-161]  1.4e-39 SSF50129
SSF50129   GroES-like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [154-284]  4.2e-28 PF00107
PF00107   ADH_zinc_N
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [28-91]  6e-08 PF08240
PF08240   ADH_N
IPR016040 NAD(P)-binding domain (Domain)
 [151-256]  1.4e-30 G3DSA:3.40.50.720
G3DSA:3.40.50.720   no description
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [11-327]  2.1e-35 SM00829
SM00829   Enoylreductase
SignalP No significant hit
TMHMM No significant hit