close all open/close all

CDS information : Actino_00050


close this sectionLocation

Organism
StrainA3(2) (=NBRC 15146)
Entry nameActinorhodin
Contig
Start / Stop / Direction4,059 / 4,703 / + [in whole cluster]
4,059 / 4,703 / + [in contig]
Location4059..4703 [in whole cluster]
4059..4703 [in contig]
TypeCDS
Length645 bp (214 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)
GeneactVI-ORF3
Gene (GenBank)ORF3
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[7929165] DNA sequence and functions of the actVI region of the actinorhodin biosynthetic gene cluster of Streptomyces coelicolor A3(2). (J Biol Chem. , 1994)
[10805574] Chemical characterisation of disruptants of the Streptomyces coelicolor A3(2) actVI genes involved in actinorhodin biosynthesis. (J Antibiot (Tokyo). , 2000)
[12421300] Primary and secondary metabolism, and post-translational protein modifications, as portrayed by proteomic analysis of Streptomyces coelicolor. (Mol Microbiol. , 2002)
Conflict
Sequence
N (71..71)
Comment
conflict with Q9ADD7 (K)

close this sectionSequence

selected fasta
>hypothetical protein
MTSSLHHAIRLTTASAIALGGLVTLGTSAHAASVAVPYECRTWVQGNTHPVYDYARGFDV
SVPASVRAGKNFKATYDPDPITAFAEYNQIVNDVRIAYRIPDGAKVHKVRLTGGSGLGDS
DVRVQVKGRDIVVSASGPFQGGVEFDLPTLKVTYKAPKTTGPLNFVSGGSGYEDPGFYWY
RYQPILDEWGPFECFPDPAKPEAVLASTQVKKHK
selected fasta
>hypothetical protein
ATGACCTCGTCGCTGCACCACGCGATACGTCTGACCACCGCGTCCGCCATCGCCCTGGGC
GGACTCGTGACCCTGGGGACCAGCGCGCACGCCGCGAGCGTCGCCGTGCCGTACGAGTGC
CGCACCTGGGTGCAGGGCAACACGCACCCGGTCTACGACTACGCGCGCGGCTTCGACGTC
AGCGTGCCCGCCTCGGTCCGCGCGGGCAAGAACTTCAAGGCCACCTACGATCCCGACCCG
ATCACCGCCTTCGCCGAGTACAACCAGATCGTCAACGACGTGCGGATCGCCTACCGGATC
CCGGACGGCGCGAAGGTCCACAAGGTGCGGCTCACCGGCGGCAGCGGTCTCGGCGACTCC
GACGTCCGGGTCCAGGTCAAGGGCCGGGACATCGTCGTCAGCGCCTCCGGCCCCTTCCAG
GGCGGTGTCGAGTTCGACCTGCCGACGCTGAAGGTCACCTACAAGGCGCCGAAGACCACC
GGCCCGCTCAACTTCGTCTCGGGCGGCTCGGGTTACGAGGACCCCGGCTTCTACTGGTAC
CGCTACCAGCCGATCCTGGACGAGTGGGGCCCCTTCGAGTGCTTCCCCGACCCGGCGAAG
CCCGAGGCCGTCCTGGCCAGCACCCAGGTCAAGAAGCACAAGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-31]  1 Signal
Bacteria, Gram-negative   
 [1-31]  1 Signal
Bacteria, Gram-positive   
 [1-31]  0.994 Signal
Eukaryota   
TMHMM No significant hit