close all open/close all

CDS information : Actino_00060


close this sectionLocation

Organism
StrainA3(2) (=NBRC 15146)
Entry nameActinorhodin
Contig
Start / Stop / Direction4,737 / 5,657 / + [in whole cluster]
4,737 / 5,657 / + [in contig]
Location4737..5657 [in whole cluster]
4737..5657 [in contig]
TypeCDS
Length921 bp (306 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)
GeneactVI-ORF4
Gene (GenBank)ORF4
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[7929165] DNA sequence and functions of the actVI region of the actinorhodin biosynthetic gene cluster of Streptomyces coelicolor A3(2). (J Biol Chem. , 1994)
[10805574] Chemical characterisation of disruptants of the Streptomyces coelicolor A3(2) actVI genes involved in actinorhodin biosynthesis. (J Antibiot (Tokyo). , 2000)
Family/Domain
FD
IPR013154
Conflict
Sequence
RTASTPP (204..210)
Comment
conflict with Q8CJS3 (PNGVDAA)

close this sectionSequence

selected fasta
>putative oxidoreductase
MPKAVAIHQFGGPDVLGLVDVPEPVPGPGQVTVRVRAAGVNGFDCRVRSGGMRGRYPVEF
PQIIGNEFAGVVERTGPEATGFAPGDEVLGFAVLQSGTELLAVGADQITVKPPELSWEVA
GSLSAVGQTADIALAELRVGPGDTVLVHAAAGGVGSLAVQLVRERGGTAIGSAGEHNHDY
LRSLGALPVAYGPGFADRVRALARTASTPPLDCHGGPEALAVSLELVADRARIATVANFR
AAAQEGIVMPRVVRSAERLAALAALCAEGRLRPHVEAVLPFAKAAEAHHRLEQGHVRGKL
VLVPDL
selected fasta
>putative oxidoreductase
ATGCCCAAGGCCGTAGCCATCCACCAGTTCGGCGGGCCGGACGTACTGGGCCTCGTCGAT
GTCCCCGAGCCGGTGCCGGGACCGGGCCAGGTGACCGTCCGAGTGCGGGCCGCCGGAGTC
AACGGGTTCGACTGCCGGGTGCGCTCCGGCGGCATGCGCGGTCGCTATCCGGTCGAGTTC
CCGCAGATCATCGGCAACGAGTTCGCCGGGGTCGTCGAGCGGACCGGACCGGAGGCGACC
GGGTTCGCGCCCGGCGACGAGGTGCTCGGGTTCGCCGTGCTTCAGTCCGGCACCGAGCTG
CTCGCCGTCGGCGCGGACCAGATCACCGTGAAACCGCCGGAGCTGTCGTGGGAGGTCGCG
GGATCCCTCTCGGCCGTCGGACAGACCGCCGACATCGCCCTGGCCGAACTGCGGGTCGGC
CCCGGGGACACCGTGCTCGTGCACGCCGCGGCCGGCGGCGTCGGCAGCCTCGCCGTCCAG
CTCGTCCGGGAGCGGGGCGGCACGGCGATCGGCAGCGCCGGCGAGCACAACCACGACTAC
CTGCGGTCGTTGGGCGCACTGCCCGTCGCCTACGGCCCGGGCTTCGCCGACCGGGTGCGG
GCCCTGGCCCGAACGGCGTCGACGCCGCCCCTCGACTGCCACGGCGGACCGGAAGCCCTC
GCCGTGTCGCTCGAACTCGTCGCGGACCGGGCCCGGATCGCCACCGTCGCCAACTTCCGC
GCCGCGGCCCAGGAGGGCATCGTCATGCCACGGGTGGTGCGGTCCGCCGAGCGGCTCGCC
GCGCTGGCCGCACTCTGCGCCGAGGGCCGGCTGCGGCCGCACGTCGAGGCCGTCCTGCCC
TTCGCCAAGGCGGCCGAGGCCCATCACCGGCTGGAGCAGGGCCATGTCCGGGGCAAGCTC
GTCCTGGTGCCGGACCTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002364 Quinone oxidoreductase/zeta-crystallin, conserved site (Conserved_site)
 [142-163]  PS01162
PS01162   QOR_ZETA_CRYSTAL
IPR011032 GroES-like (Domain)
 [1-151]  2.80000504261099e-35 SSF50129
SSF50129   GroES_like
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [28-94]  6.80000000000001e-13 PF08240
PF08240   ADH_N
IPR016040 NAD(P)-binding domain (Domain)
 [151-257]  7.4e-16 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit