close all open/close all

CDS information : Actino_00070


close this sectionLocation

Organism
StrainA3(2) (=NBRC 15146)
Entry nameActinorhodin
Contig
Start / Stop / Direction5,689 / 7,290 / + [in whole cluster]
19 / 1,620 / + [in contig]
Location5689..7290 [in whole cluster]
19..1620 [in contig]
TypeCDS
Length1,602 bp (533 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productdrug resistance transporter
Product (GenBank)
GeneactVA-ORF1
Gene (GenBank)actVA 1
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[1766437] Organisation and functions of the actVA region of the actinorhodin biosynthetic gene cluster of Streptomyces coelicolor. (Mol Gen Genet. , 1991)
[8636024] Production of actinorhodin-related "blue pigments" by Streptomyces coelicolor A3(2). (J Bacteriol. , 1996)

close this sectionSequence

selected fasta
>drug resistance transporter
MTANPGRPGGPADQGHPRRWAILGVLVLSLVGIILDNTVLNVTLRTLTDPEQGLGASHSQ
VEWVLSAYTLAFAATLFTWGVLGDRLGRRRVLLLGLGLFGLSSLAGAYAGSPEQLIAARA
CMGVSGAAVLPSTLATIAAVFPLRERPKALGIWAASVGFALGIGPVTGGILLAHFWWGSV
LLVNVPLMAGCLVAVVLVVPETRGTAGRRVDAAGLLLSIAGVVPLVYAIIEAGRSGGVTR
PAVWAAGLAGLGLLLVFLWHERRTPEPSLELGFFRMKAFSTAVAAVGFVSFAMMGFLFFS
AFYLQSVRGYTPLQAGGCTVALAVANVVCGPLSTVLVRSIGPRNVCAAGMLAVTASLCGV
TFVTQHAPVWLILVLFAALGAGVACVMPTAAVSIMNAIPREKAGVASAMNNTVRQLGGAL
GVAVLGSLMGAAYRRGIEDELAVLPPSARHQAGESLDATLLAATRLGESGLVGPARQAFL
DAMHLAAGAAAAVALVGALAVLRWLPSSVTTPTPPAGAVPGREHSDHLKVQGS
selected fasta
>drug resistance transporter
GTGACGGCGAACCCCGGCCGTCCGGGCGGCCCGGCGGACCAGGGCCACCCGCGCCGCTGG
GCCATCCTCGGGGTGCTGGTCCTCAGCCTGGTCGGCATCATCCTCGACAACACCGTGCTC
AACGTGACGCTGCGCACCCTCACCGACCCCGAGCAGGGCCTGGGCGCCTCGCACAGCCAG
GTGGAATGGGTGCTCAGCGCCTACACCCTGGCCTTCGCGGCGACGCTGTTCACCTGGGGA
GTGCTGGGCGACCGACTGGGCCGCAGGCGGGTACTCCTGCTGGGCCTCGGCCTGTTCGGA
CTGTCGTCCCTGGCCGGGGCCTACGCCGGGTCGCCGGAGCAGCTCATCGCCGCCCGTGCC
TGCATGGGGGTGAGCGGCGCGGCGGTGCTGCCGAGCACACTCGCCACCATCGCCGCCGTC
TTCCCGCTGCGCGAGCGGCCCAAGGCCCTCGGGATCTGGGCGGCCTCGGTCGGCTTCGCC
CTCGGCATCGGGCCCGTCACCGGCGGGATACTGCTCGCGCACTTCTGGTGGGGCTCGGTC
CTGCTGGTCAACGTGCCCCTCATGGCCGGGTGCCTGGTCGCGGTGGTGCTGGTGGTGCCC
GAGACCCGGGGCACGGCGGGCAGGCGCGTCGACGCGGCCGGACTGCTGCTCTCGATCGCG
GGTGTCGTGCCGCTCGTCTACGCGATCATCGAGGCCGGCCGGAGCGGCGGGGTCACCCGG
CCCGCGGTCTGGGCAGCCGGCCTGGCGGGCCTCGGCCTGCTCCTCGTGTTCCTGTGGCAC
GAGCGCCGTACCCCGGAACCCTCGCTGGAGCTCGGCTTCTTCCGGATGAAGGCCTTCTCC
ACCGCCGTCGCGGCCGTCGGCTTCGTCAGCTTCGCGATGATGGGCTTCCTCTTCTTCAGC
GCCTTCTACCTGCAGAGCGTGCGCGGCTACACACCCCTGCAGGCCGGGGGATGCACCGTG
GCACTGGCCGTCGCGAACGTGGTCTGCGGACCGCTCAGCACGGTCCTGGTGCGTTCGATC
GGCCCCCGGAACGTGTGCGCGGCGGGCATGCTGGCCGTCACCGCATCGCTCTGCGGGGTC
ACCTTCGTGACCCAGCACGCACCCGTATGGCTGATCCTCGTCCTGTTCGCCGCGCTGGGG
GCGGGCGTAGCATGCGTCATGCCGACCGCGGCCGTGTCCATCATGAACGCGATCCCACGC
GAGAAGGCGGGCGTCGCCTCGGCGATGAACAACACCGTGCGCCAGCTGGGCGGCGCCCTG
GGCGTCGCGGTGCTCGGTTCCCTCATGGGCGCCGCGTACCGCCGCGGCATCGAGGACGAG
CTCGCCGTACTGCCGCCCTCCGCGCGGCACCAGGCCGGCGAGTCCCTGGATGCCACCCTG
CTGGCCGCGACTAGGCTGGGGGAGAGCGGACTTGTCGGCCCCGCGCGCCAGGCATTCCTG
GACGCCATGCACCTGGCCGCCGGGGCCGCTGCCGCGGTGGCGCTCGTGGGGGCCCTTGCC
GTGCTCCGCTGGCTGCCCTCCTCCGTCACGACTCCGACGCCCCCGGCAGGGGCCGTGCCC
GGCCGGGAGCATTCCGATCACCTCAAGGTCCAAGGAAGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001411 Tetracycline resistance protein TetB/drug resistance transporter (Family)
 [25-49]  1e-05 PR01036 [88-110]  1e-05 PR01036 [149-173]  1e-05 PR01036 [412-431]  1e-05 PR01036
PR01036   TCRTETB
IPR011701 Major facilitator superfamily (Family)
 [28-421]  5.8e-55 PF07690
PF07690   MFS_1
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [1-506]  6e-74 SSF103473
SSF103473   MFS general substrate transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [22-509]  35.219 PS50850
PS50850   MFS
SignalP
 [1-35]  0.426 Signal
Eukaryota   
TMHMM
 [21-43]  Transmembrane (i-o) [63-83]  Transmembrane (o-i) [90-109]  Transmembrane (i-o) [124-143]  Transmembrane (o-i) [150-172]  Transmembrane (i-o) [177-199]  Transmembrane (o-i) [212-231]  Transmembrane (i-o) [241-258]  Transmembrane (o-i) [278-300]  Transmembrane (i-o) [315-337]  Transmembrane (o-i) [344-363]  Transmembrane (i-o) [373-395]  Transmembrane (o-i) [416-433]  Transmembrane (i-o) [483-505]  Transmembrane (o-i)
Transmembrane 14