close all open/close all

CDS information : Actino_00080


close this sectionLocation

Organism
StrainA3(2) (=NBRC 15146)
Entry nameActinorhodin
Contig
Start / Stop / Direction7,292 / 7,687 / + [in whole cluster]
1,622 / 2,017 / + [in contig]
Location7292..7687 [in whole cluster]
1622..2017 [in contig]
TypeCDS
Length396 bp (131 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.2 function unknown
Productpyridoxamine 5'-phosphate oxidase-like FMN-binding domain protein
Product (GenBank)
GeneactVA-ORF2
Gene (GenBank)actVA 2
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[1766437] Organisation and functions of the actVA region of the actinorhodin biosynthetic gene cluster of Streptomyces coelicolor. (Mol Gen Genet. , 1991)
Family/Domain
FD
IPR011576
Conflict
Sequence
HA (97..98)
Comment
conflict with Q93IZ3 (QP)

close this sectionSequence

selected fasta
>pyridoxamine 5'-phosphate oxidase-like FMN-binding domain protein
MPFTPDELEYYASQNLGRLATVAPDGQPQANPVSFRVNTETGTIDIGGHNLTASKKFRNV
TKHDQVAFVVDDLISTQPWNVRGIEVRGRAEALTDAHAPHPYFGTAMIRIHPKRIITWGL
GGDAAQRGRDV
selected fasta
>pyridoxamine 5'-phosphate oxidase-like FMN-binding domain protein
ATGCCTTTCACTCCTGACGAGCTCGAGTACTACGCCTCCCAGAACCTCGGCCGGCTGGCC
ACCGTGGCGCCCGACGGCCAGCCCCAGGCCAACCCGGTCTCGTTCCGCGTCAACACCGAG
ACCGGCACGATCGACATCGGCGGGCACAACCTGACCGCCAGCAAGAAGTTCCGCAACGTC
ACCAAGCACGACCAGGTCGCCTTCGTCGTCGACGACCTGATCTCCACGCAGCCGTGGAAC
GTACGCGGTATCGAAGTGCGCGGCCGGGCCGAGGCGCTGACCGACGCGCACGCGCCGCAC
CCCTACTTCGGTACCGCGATGATCCGTATCCACCCCAAGCGCATCATCACCTGGGGCCTC
GGCGGCGACGCCGCCCAGCGCGGCCGCGACGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009002 FMN-binding split barrel-related (Domain)
 [1-123]  3.0999994589937e-20 SSF50475
SSF50475   FMN_binding
IPR011576 Pyridoxamine 5'-phosphate oxidase-like, FMN-binding domain (Domain)
 [4-96]  1.4e-16 PF01243
PF01243   Pyridox_oxidase
IPR012349 FMN-binding split barrel (Domain)
 [3-116]  2.2e-16 G3DSA:2.30.110.10
G3DSA:2.30.110.10   PNPOx_FMN_bd
IPR024031 F420-dependent enzyme, PPOX class, family MSMEG5819, probable (Family)
 [3-120]  2.89999999999999e-52 TIGR04023
TIGR04023   PPOX_MSMEG_5819
SignalP No significant hit
TMHMM No significant hit