close all open/close all

CDS information : Actino_00090


close this sectionLocation

Organism
StrainA3(2) (=NBRC 15146)
Entry nameActinorhodin
Contig
Start / Stop / Direction7,782 / 8,627 / + [in whole cluster]
2,112 / 2,957 / + [in contig]
Location7782..8627 [in whole cluster]
2112..2957 [in contig]
TypeCDS
Length846 bp (281 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)
GeneactVA-ORF3
Gene (GenBank)actVA 3
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[1766437] Organisation and functions of the actVA region of the actinorhodin biosynthetic gene cluster of Streptomyces coelicolor. (Mol Gen Genet. , 1991)
Related Reference
ACC
B6SEG3
NITE
Alnu_00180
PmId
[22474343] Biosynthetic pathway toward carbohydrate-like moieties of alnumycins contains unusual steps for C-C bond formation and cleavage. (Proc Natl Acad Sci U S A. , 2012)
Conflict
Sequence
S (179..179)
Comment
conflict with Q93IZ2 (Y)

close this sectionSequence

selected fasta
>hypothetical protein
MSTEIFHEEFAGGLVTEGPGAPWRLRPVDGLEAGDGLVRGGPDGLVVVPSAAHPGTRRPA
FTEPKPGPDGTPLHLRWGAFTTGGTTGGTAGARAAFTAVPGERLSVRAEMGLRGFGLRSH
PYDDVTEPDADARLGAGGLISVDLESGIIFDFFLTHSRLYAVYERLALRPDAEFAAFTSC
VPVADRTPGTLHRLEVGYDVAAGTAHWTADGQEVLSVDRIGFRALDARWLRRDNGGREEA
VRPRGLSFGLGLFLERHFGQGVRLSVRRLSVLTSPAGSRDS
selected fasta
>hypothetical protein
ATGAGTACAGAGATCTTCCATGAGGAGTTCGCCGGGGGGCTGGTGACCGAGGGGCCGGGC
GCGCCGTGGCGGCTTCGCCCGGTCGACGGTCTCGAGGCGGGAGACGGGCTGGTCCGCGGG
GGACCGGACGGCCTGGTGGTCGTGCCGAGCGCCGCCCACCCGGGGACCCGGCGGCCGGCG
TTCACCGAGCCCAAGCCCGGGCCGGACGGCACCCCGCTGCATCTGCGGTGGGGTGCCTTC
ACCACCGGCGGCACCACCGGCGGCACCGCCGGCGCGCGGGCGGCGTTCACCGCCGTGCCC
GGCGAACGGCTCTCGGTCAGGGCCGAGATGGGGCTGCGCGGCTTCGGTCTGCGCTCCCAT
CCGTACGACGACGTGACCGAACCCGACGCGGACGCCCGGCTCGGCGCGGGCGGTCTGATC
TCGGTCGATCTCGAGTCCGGGATCATCTTCGACTTCTTCCTCACACACAGCCGGCTCTAC
GCGGTCTACGAGCGGCTCGCGCTGCGGCCGGACGCCGAGTTCGCGGCCTTCACCTCATGC
GTCCCGGTCGCGGACCGCACCCCCGGCACGCTCCACCGGCTCGAGGTCGGATACGACGTC
GCGGCCGGCACCGCCCACTGGACGGCCGACGGGCAGGAGGTCCTGTCCGTGGACCGGATC
GGCTTCCGCGCACTGGACGCGCGCTGGCTCCGGCGGGACAACGGCGGCCGCGAGGAGGCC
GTACGGCCGCGCGGACTCAGCTTCGGCCTCGGGCTCTTCCTGGAGCGCCACTTCGGCCAG
GGGGTGCGGCTGTCGGTGCGAAGGCTGTCGGTGCTCACCTCGCCCGCCGGCTCCCGCGAC
TCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit