close all open/close all

CDS information : Actino_00100


close this sectionLocation

Organism
StrainA3(2) (=NBRC 15146)
Entry nameActinorhodin
Contig
Start / Stop / Direction8,652 / 9,536 / + [in whole cluster]
2,982 / 3,866 / + [in contig]
Location8652..9536 [in whole cluster]
2982..3866 [in contig]
TypeCDS
Length885 bp (294 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Producthypothetical protein
Product (GenBank)
GeneactVA-ORF4
Gene (GenBank)actVA 4
EC number
Keyword
  • dimerization
Note
Note (GenBank)
Reference
ACC
PmId
[1766437] Organisation and functions of the actVA region of the actinorhodin biosynthetic gene cluster of Streptomyces coelicolor. (Mol Gen Genet. , 1991)
[22765902] Identification of the actinorhodin monomer and its related compound from a deletion mutant of the actVA-ORF4 gene of Streptomyces coelicolor A3(2). (Bioorg Med Chem Lett. , 2012)
[25690356] Structure and biosynthetic implication of 5R-(N-acetyl-L-cysteinyl)-14S-hydroxy-dihydrokalafungin from a mutant of the actVA-ORF4 gene for actinorhodin biosynthesis in Streptomyces coelicolor A3(2). (J Antibiot (Tokyo). , 2015)

close this sectionSequence

selected fasta
>hypothetical protein
MPDENKPVLVLGATGKQGGSAARYLLERGWTVRAFVRDPGAPKAKELRELGASLHTGDLE
DAGSVRAAMKGAYGVFSIQTPMTPAGVEGEERQGKICADAARDLGVQHYVHSSVGGAERP
EGVNWRLSKLAIEQRIQENALRFTFLRPSYFMENLNHDMSPLVMEDGVLTFRRGLGPANT
LQMISGPDIGYFAADAFDDPDTFGGAKIELAGDELTGEQIAAAFGRHTGLPARFVSVPIP
ELHRTGFEWQAISYTWLNGIGYHADIPTLRARFPQLLTLDQWLARTGWTPRDPA
selected fasta
>hypothetical protein
ATGCCCGATGAGAACAAGCCCGTACTGGTCCTCGGCGCCACCGGAAAGCAAGGCGGCTCC
GCGGCCCGGTACCTGCTGGAACGCGGCTGGACAGTCCGGGCCTTCGTCCGGGACCCCGGC
GCGCCCAAGGCCAAGGAGCTGCGTGAGCTGGGGGCGAGCCTGCACACCGGCGACCTGGAG
GACGCCGGCTCGGTGCGCGCCGCGATGAAGGGTGCGTACGGCGTGTTCAGCATCCAAACG
CCGATGACACCGGCCGGCGTGGAGGGCGAGGAGCGGCAGGGCAAGATATGCGCCGACGCC
GCCCGCGACCTCGGCGTCCAGCACTACGTCCACAGCTCGGTGGGCGGCGCGGAACGGCCG
GAGGGCGTGAACTGGCGGCTGTCCAAGCTCGCGATCGAGCAGCGGATCCAGGAGAACGCG
CTCCGGTTCACCTTCCTGCGGCCGTCGTACTTCATGGAGAACCTGAACCACGACATGTCG
CCCCTCGTCATGGAGGACGGCGTGCTGACCTTCCGGAGGGGGCTCGGGCCGGCCAACACC
CTGCAGATGATCAGCGGCCCCGACATCGGGTACTTCGCGGCCGACGCCTTCGACGACCCC
GACACCTTCGGCGGCGCCAAGATCGAGCTGGCCGGGGACGAGCTGACCGGCGAGCAGATC
GCGGCCGCGTTCGGCCGGCACACCGGGCTGCCCGCCCGCTTCGTGTCGGTGCCGATACCG
GAGCTGCACCGCACGGGGTTCGAGTGGCAGGCGATCTCGTACACCTGGCTCAACGGCATC
GGCTATCACGCCGACATCCCCACGCTGCGCGCCCGGTTCCCGCAGCTGCTCACCCTCGAC
CAGTGGCTGGCCAGGACCGGCTGGACCCCGAGGGACCCGGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR008030 NmrA-like (Domain)
 [8-235]  7.9e-44 PF05368
PF05368   NmrA
IPR016040 NAD(P)-binding domain (Domain)
 [4-224]  1.3e-68 G3DSA:3.40.50.720
G3DSA:3.40.50.720   no description
SignalP
 [1-34]  0.075 Signal
Eukaryota   
TMHMM No significant hit