close all open/close all

CDS information : Actino_00110


close this sectionLocation

Organism
StrainA3(2) (=NBRC 15146)
Entry nameActinorhodin
Contig
Start / Stop / Direction9,533 / 10,678 / + [in whole cluster]
3,863 / 5,008 / + [in contig]
Location9533..10678 [in whole cluster]
3863..5008 [in contig]
TypeCDS
Length1,146 bp (381 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
ProductFMNH2-dependent monooxygenase
Product (GenBank)
GeneactVA-ORF5
Gene (GenBank)actVA 5
EC number
Keyword
  • two-component system
  • C-6 quinone formation
  • C-8 hydroxylate
Note
Note (GenBank)
Reference
ACC
PmId
[1766437] Organisation and functions of the actVA region of the actinorhodin biosynthetic gene cluster of Streptomyces coelicolor. (Mol Gen Genet. , 1991)
[18245777] Mechanism and regulation of the Two-component FMN-dependent monooxygenase ActVA-ActVB from Streptomyces coelicolor. (J Biol Chem. , 2008)
[19246012] Biosynthesis of actinorhodin and related antibiotics: discovery of alternative routes for quinone formation encoded in the act gene cluster. (Chem Biol. , 2009)
[22086671] Epoxyquinone formation catalyzed by a two-component flavin-dependent monooxygenase involved in biosynthesis of the antibiotic actinorhodin. (Chembiochem. , 2011)
[23601640] Biosynthetic conclusions from the functional dissection of oxygenases for biosynthesis of actinorhodin and related streptomyces antibiotics. (Chem Biol. , 2013)

close this sectionSequence

selected fasta
>FMNH2-dependent monooxygenase
MSEDTMTQERPSLTAHARRIAELAGKRAADAEQQRRLSPDVVDAVLRAGFAAHFVPVAHG
GRAATFGELVEPVAVLGEACASTAWYASLTASLGRMAAYLPDEGQAELWSDGPDALIVGA
LMPLGRAEKTPGGWHVSGTWPFVSVVDHSDWALICAKVGEEPWFFAVPRQEYGIVDSWYP
MGMRGTGSNTLVLDGVFVPDARACTRAAIAAGLGPDAEAICHTVPMRAVNGLAFALPMLG
AARGAAAVWTSWTAGRLAGPTGQNAVSSQDRVVYEHTLARATGEIDAAQLLLERVAAVAD
AGSATGVLVGRGARDCALAAELLTAATDRLFASAGTRAQAQDSPMQRLWRDVHAAGSHIG
LQFGPGAALYAGELLRRSNDG
selected fasta
>FMNH2-dependent monooxygenase
ATGAGCGAGGACACGATGACCCAGGAGCGGCCGTCCCTGACGGCACACGCCCGCCGGATC
GCCGAACTCGCCGGGAAGCGGGCGGCCGACGCCGAACAGCAGCGCCGGCTGAGCCCCGAC
GTCGTCGACGCGGTCCTTCGAGCCGGTTTCGCCGCCCACTTCGTACCGGTGGCGCACGGC
GGCCGGGCCGCGACGTTCGGGGAGCTGGTGGAGCCCGTCGCGGTGCTCGGCGAGGCCTGT
GCCTCGACCGCCTGGTACGCCTCGCTCACGGCGAGCCTCGGCCGGATGGCCGCCTACCTG
CCGGACGAGGGCCAGGCCGAGCTGTGGTCCGACGGCCCCGACGCCCTGATCGTCGGTGCC
CTGATGCCGCTGGGCCGGGCCGAGAAGACCCCGGGCGGCTGGCACGTGTCGGGCACCTGG
CCGTTCGTCAGCGTCGTGGATCACTCCGACTGGGCGCTGATCTGCGCCAAGGTCGGCGAG
GAGCCGTGGTTCTTCGCGGTGCCGCGACAGGAGTACGGGATCGTCGACAGCTGGTACCCG
ATGGGTATGCGCGGAACGGGCAGCAACACGCTCGTCCTCGACGGGGTGTTCGTGCCGGAT
GCGCGGGCCTGCACCCGTGCGGCCATCGCGGCAGGTCTCGGTCCGGATGCCGAGGCGATC
TGTCACACCGTGCCCATGAGGGCGGTCAACGGGCTGGCCTTCGCACTGCCGATGCTCGGC
GCGGCCCGCGGGGCCGCGGCCGTGTGGACCTCGTGGACCGCCGGAAGACTGGCCGGGCCG
ACCGGGCAGAACGCCGTCTCGTCCCAGGACCGCGTGGTGTACGAGCACACGCTGGCCCGG
GCCACGGGTGAGATCGACGCGGCCCAGCTGCTGTTGGAGCGGGTCGCGGCGGTCGCCGAC
GCCGGCTCGGCGACCGGCGTACTGGTCGGCCGCGGGGCGCGGGACTGCGCCCTGGCGGCG
GAGCTGCTGACCGCCGCGACCGACCGGCTGTTCGCCTCGGCGGGCACCCGGGCACAGGCC
CAGGACAGCCCGATGCAGCGCCTGTGGCGCGATGTGCACGCGGCGGGCAGCCATATCGGG
CTGCAGTTCGGGCCCGGGGCGGCGCTGTACGCCGGAGAGCTGTTGAGGAGGAGCAACGAT
GGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006091 Acyl-CoA oxidase/dehydrogenase, central domain (Domain)
 [120-196]  3.3e-22 G3DSA:2.40.110.10
G3DSA:2.40.110.10   no description
IPR009075 Acyl-CoA dehydrogenase/oxidase C-terminal (Domain)
 [217-360]  2e-08 SSF47203
SSF47203   Acyl-CoA dehydrogenase C-terminal domain-like
 [197-377]  1.7e-28 G3DSA:1.20.140.10
G3DSA:1.20.140.10   no description
IPR009100 Acyl-CoA dehydrogenase/oxidase (Domain)
 [1-206]  1.1e-32 SSF56645
SSF56645   Acyl-CoA dehydrogenase NM domain-like
IPR013107 Acyl-CoA dehydrogenase, type 2, C-terminal (Domain)
 [232-362]  5.3e-36 PF08028
PF08028   Acyl-CoA_dh_2
IPR013786 Acyl-CoA dehydrogenase/oxidase, N-terminal (Domain)
 [3-115]  1.4e-27 G3DSA:1.10.540.10
G3DSA:1.10.540.10   no description
SignalP No significant hit
TMHMM No significant hit