close all open/close all

CDS information : Actino_00120


close this sectionLocation

Organism
StrainA3(2) (=NBRC 15146)
Entry nameActinorhodin
Contig
Start / Stop / Direction10,671 / 11,012 / + [in whole cluster]
5,001 / 5,342 / + [in contig]
Location10671..11012 [in whole cluster]
5001..5342 [in contig]
TypeCDS
Length342 bp (113 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
ProductC-6 monooxygenase
Product (GenBank)
GeneactVA-ORF6
Gene (GenBank)actVA 6
EC number
Keyword
  • alternative
  • quinone formation
Note
Note (GenBank)
Reference
ACC
PmId
[1766437] Organisation and functions of the actVA region of the actinorhodin biosynthetic gene cluster of Streptomyces coelicolor. (Mol Gen Genet. , 1991)
[9209048] Identification of a monooxygenase from Streptomyces coelicolor A3(2) involved in biosynthesis of actinorhodin: purification and characterization of the recombinant enzyme. (J Bacteriol. , 1997)
[19246012] Biosynthesis of actinorhodin and related antibiotics: discovery of alternative routes for quinone formation encoded in the act gene cluster. (Chem Biol. , 2009)

close this sectionSequence

selected fasta
>C-6 monooxygenase
MAEVNDPRVGFVAVVTFPVDGPATQHKLVELATGGVQEWIREVPGFLSATYHASTDGTAV
VNYAQWESEQAYRVNFGADPRSAELREALSSLPGLMGPPKAVFMTPRGAILPS
selected fasta
>C-6 monooxygenase
ATGGCTGAAGTGAACGATCCCCGGGTGGGCTTCGTCGCGGTCGTCACCTTCCCGGTGGAC
GGCCCCGCCACCCAGCACAAGCTGGTGGAGCTGGCCACCGGCGGGGTGCAGGAGTGGATC
CGCGAGGTGCCCGGCTTCCTGTCGGCCACGTATCACGCGAGCACGGACGGGACCGCGGTC
GTCAACTACGCCCAGTGGGAGAGCGAGCAGGCCTACCGGGTGAACTTCGGCGCCGACCCG
CGCTCGGCGGAGCTGCGGGAGGCGCTGAGCTCGCTGCCCGGGCTCATGGGGCCGCCGAAG
GCCGTGTTCATGACTCCGCGGGGGGCGATCCTGCCGTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007138 Antibiotic biosynthesis monooxygenase (Domain)
 [11-76]  3.7e-14 PF03992
PF03992   ABM
IPR011008 Dimeric alpha-beta barrel (Domain)
 [1-113]  1.4e-24 SSF54909
SSF54909   Dimeric alpha+beta barrel
SignalP No significant hit
TMHMM No significant hit