close all open/close all

CDS information : Actino_00130


close this sectionLocation

Organism
StrainA3(2) (=NBRC 15146)
Entry nameActinorhodin
Contig
Start / Stop / Direction12,042 / 11,263 / - [in whole cluster]
972 / 193 / - [in contig]
Locationcomplement(11263..12042) [in whole cluster]
complement(193..972) [in contig]
TypeCDS
Length780 bp (259 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
ProductTetR family transcriptional repressor
Product (GenBank)
GeneactII-ORF1
actR
Gene (GenBank)actII
EC number
Keyword
Note
Note (GenBank)
  • ORF1
Reference
ACC
PmId
[1878971] The act cluster contains regulatory and antibiotic export genes, direct targets for translational control by the bldA tRNA gene of Streptomyces. (Cell. , 1991)
[17644591] Investigation of transcription repression and small-molecule responsiveness by TetR-like transcription factors using a heterologous Escherichia coli-based assay. (J Bacteriol. , 2007)
[17338074] Initiation of actinorhodin export in Streptomyces coelicolor. (Mol Microbiol. , 2007)
[18207163] Crystal structures of the Streptomyces coelicolor TetR-like protein ActR alone and in complex with actinorhodin or the actinorhodin biosynthetic precursor (S)-DNPA. (J Mol Biol. , 2008)
[18804114] Ligand recognition by ActR, a TetR-like regulator of actinorhodin export. (J Mol Biol. , 2008)
[23073761] A two-step mechanism for the activation of actinorhodin export and resistance in Streptomyces coelicolor. (MBio. , 2012)

close this sectionSequence

selected fasta
>TetR family transcriptional repressor
MSRSEEGRPMPEEIPVPPWRRPKKAPPRMPLTQDRIVVTALGILDAEGLDALSMRRLAQE
LKTGHASLYAHVGNRDELLDLVFDIVLTEVEVPEPEPGRWAEQVKEMCRSLRRMFLAHRD
LARIAIDRVPLGPNGMVGMERTMNLLRSGGLHDELAAYGGDLLSTFVTAEALEQSSRNPG
TEQGREQAGVFADQLHGYLKSLPATSFPNLVHLAGPITSLDSDRRFELGLEIIIAGLLAG
AGEAADDQVRTAGSPPAES
selected fasta
>TetR family transcriptional repressor
GTGTCGCGAAGCGAGGAAGGGAGGCCCATGCCCGAGGAGATTCCCGTGCCTCCGTGGCGC
CGGCCGAAGAAGGCGCCGCCGCGCATGCCCCTGACCCAGGACCGGATCGTCGTCACGGCG
CTCGGCATCCTCGACGCCGAGGGACTCGACGCCCTGAGCATGCGGCGGCTCGCGCAGGAG
CTGAAGACCGGACACGCCTCGCTGTACGCGCACGTGGGGAACCGGGACGAGCTGCTCGAC
CTCGTCTTCGACATCGTGCTGACCGAGGTGGAGGTCCCGGAACCGGAACCCGGCCGCTGG
GCGGAGCAGGTCAAGGAGATGTGCCGGTCGCTGCGGAGGATGTTCCTGGCCCACCGGGAC
CTGGCACGGATCGCGATCGACCGGGTGCCGCTGGGACCCAACGGGATGGTGGGGATGGAG
CGCACCATGAACCTGCTGCGCTCCGGGGGCCTGCACGACGAACTCGCCGCCTACGGGGGC
GACCTGCTGTCGACCTTCGTCACGGCGGAGGCCCTGGAGCAGTCGTCCCGCAACCCCGGA
ACGGAACAGGGCCGGGAGCAGGCCGGCGTGTTCGCCGACCAGCTCCACGGCTACCTGAAG
TCACTGCCGGCCACCAGTTTCCCGAACCTGGTCCACCTGGCCGGCCCGATCACCTCGCTC
GACTCCGACCGCCGGTTCGAGCTCGGCCTCGAGATCATCATCGCCGGCCTGCTGGCCGGG
GCCGGCGAGGCCGCGGACGACCAGGTCAGGACGGCAGGATCGCCCCCCGCGGAGTCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001647 DNA-binding HTH domain, TetR-type (Domain)
 [36-80]  1.5e-09 PF00440
PF00440   TetR_N
 [30-90]  16.019 PS50977
PS50977   HTH_TETR_2
IPR003012 Tetracycline transcriptional regulator, TetR (Family)
 [48-71]  2.5e-06 PR00400 [100-119]  2.5e-06 PR00400 [156-175]  2.5e-06 PR00400
PR00400   TETREPRESSOR
IPR004111 Tetracycline transcriptional regulator, TetR, C-terminal (Domain)
 [95-239]  6.9e-41 PF02909
PF02909   TetR_C
IPR009057 Homeodomain-like (Domain)
 [20-84]  4.7e-18 G3DSA:1.10.10.60
G3DSA:1.10.10.60   no description
 [29-90]  2.6e-11 SSF46689
SSF46689   Homeodomain-like
IPR011075 Tetracycline transcriptional regulator, TetR-related, C-terminal (Domain)
 [98-246]  8.7e-27 SSF48498
SSF48498   Tetracyclin repressor-like, C-terminal domain
IPR015893 Tetracycline transcriptional regulator, TetR-like, C-terminal (Domain)
 [85-237]  9.6e-35 G3DSA:1.10.357.10
G3DSA:1.10.357.10   no description
SignalP No significant hit
TMHMM No significant hit