close all open/close all

CDS information : Actino_00140


close this sectionLocation

Organism
StrainA3(2) (=NBRC 15146)
Entry nameActinorhodin
Contig
Start / Stop / Direction12,153 / 13,889 / + [in whole cluster]
1,083 / 2,819 / + [in contig]
Location12153..13889 [in whole cluster]
1083..2819 [in contig]
TypeCDS
Length1,737 bp (578 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productdrug resistance transporter
Product (GenBank)
GeneactII-ORF2
actA
Gene (GenBank)actII
EC number
Keyword
Note
Note (GenBank)
  • ORF2
Reference
ACC
PmId
[1878971] The act cluster contains regulatory and antibiotic export genes, direct targets for translational control by the bldA tRNA gene of Streptomyces. (Cell. , 1991)
[8636024] Production of actinorhodin-related "blue pigments" by Streptomyces coelicolor A3(2). (J Bacteriol. , 1996)
[17644591] Investigation of transcription repression and small-molecule responsiveness by TetR-like transcription factors using a heterologous Escherichia coli-based assay. (J Bacteriol. , 2007)
[17338074] Initiation of actinorhodin export in Streptomyces coelicolor. (Mol Microbiol. , 2007)
[23073761] A two-step mechanism for the activation of actinorhodin export and resistance in Streptomyces coelicolor. (MBio. , 2012)

close this sectionSequence

selected fasta
>drug resistance transporter
MSSVEADEPDRATAPPSALLPEDGPGPDGTAAGPPPYARRWAALGVILGAEIMDLLDGTV
MNVAAPAVRADLGGSLSVIQWITVGYTLAFAVLLVVGGRLGDIYGRKRMFVVGAVGFTAA
SVLCSVAAGPEMLTAARFLQGGLGALMIPQGLGLIKQMFPPKETAAAFGAFGPAIGLGAV
LGPIVAGFLVDADLFGTGWRSVFLINLPIGVAVIVGAVLLLPEGKAPVRPKFDVVGMALV
TSGLTLLIFPLVQGRERGWPAWAFVLMLAGAAVLVGFVAHELRQERRGGATLIELSLLRR
SRYAAGLAVALVFFTGVSGMSLLLALHLQIGLGFSPTRAALTMTPWSVFLVVGAILTGAV
LGSKFGRKALHGGLVVLALGVLIMLLTIGDQAGGLTSWELVPGIAVAGLGMGIMIGLLFD
IALADVDKQEAGTASGVLTAVQQLGFTVGVAVLGTLFFGLLGSQATASVDDGASRARTEL
AAAGASTTEQDRLLADLRVCLRESASQQDSERTPDSCRNLQQARPAVAEATARAWRTAHT
ENFSTAMVRTLWVVIALLAVSFALAFRLPPKPREEEGF
selected fasta
>drug resistance transporter
ATGAGTTCCGTTGAAGCCGACGAGCCGGACAGGGCCACGGCCCCGCCGTCGGCGTTACTG
CCCGAGGACGGCCCCGGACCGGACGGAACCGCGGCCGGACCCCCGCCCTACGCGCGCCGT
TGGGCCGCGCTGGGAGTCATCCTCGGCGCCGAGATCATGGACCTGCTCGACGGCACGGTC
ATGAACGTGGCCGCGCCCGCCGTCCGCGCGGACCTGGGCGGCAGCCTCAGCGTCATCCAG
TGGATCACCGTCGGGTACACGCTCGCGTTCGCCGTCCTGCTCGTGGTGGGCGGCCGGCTG
GGCGACATCTACGGCCGCAAGCGCATGTTCGTCGTCGGCGCCGTCGGCTTCACCGCGGCC
TCCGTGCTGTGCTCGGTGGCGGCCGGTCCCGAGATGCTCACCGCGGCACGCTTCCTTCAG
GGCGGGCTCGGCGCGCTGATGATTCCGCAAGGGCTCGGTCTCATCAAGCAAATGTTCCCG
CCCAAGGAGACGGCGGCGGCGTTCGGCGCGTTCGGACCCGCCATCGGGCTGGGCGCCGTG
CTCGGCCCGATCGTCGCCGGGTTCCTGGTCGACGCCGACCTGTTCGGCACGGGCTGGCGG
TCCGTCTTCCTGATCAATCTGCCGATCGGCGTGGCCGTGATCGTCGGCGCGGTCCTGCTG
CTGCCCGAGGGCAAGGCGCCCGTGCGGCCGAAGTTCGACGTCGTCGGCATGGCGCTGGTG
ACGTCCGGGCTCACCCTGCTCATCTTCCCGCTCGTCCAGGGGCGCGAACGCGGCTGGCCC
GCCTGGGCGTTCGTGCTGATGCTGGCCGGAGCGGCCGTGCTCGTCGGCTTCGTCGCCCAC
GAACTGCGGCAGGAGAGGCGCGGCGGCGCCACGCTCATCGAGCTCAGCCTGCTGCGCAGG
TCCCGCTACGCCGCGGGACTGGCGGTGGCACTGGTGTTCTTCACCGGCGTCTCCGGAATG
TCGCTGCTGCTCGCCCTGCACCTGCAGATCGGCCTGGGCTTCAGCCCCACCAGGGCCGCG
CTGACCATGACGCCCTGGTCGGTGTTCCTCGTCGTCGGCGCGATCCTGACCGGGGCGGTG
CTGGGATCGAAGTTCGGCCGCAAGGCCCTGCACGGCGGGCTCGTGGTGCTGGCGCTGGGC
GTGCTGATCATGCTGTTGACGATCGGCGACCAGGCCGGCGGGCTGACCAGCTGGGAGCTC
GTCCCCGGTATCGCCGTTGCCGGGCTCGGCATGGGCATCATGATCGGACTGCTCTTCGAC
ATCGCCCTGGCCGACGTCGACAAGCAGGAGGCCGGTACCGCCTCCGGCGTCCTCACCGCG
GTCCAGCAGCTCGGCTTCACCGTGGGCGTCGCGGTGCTCGGGACCCTGTTCTTCGGGCTG
CTCGGCTCACAGGCCACGGCGAGCGTCGACGACGGCGCGAGCCGGGCCCGCACCGAACTC
GCCGCCGCCGGGGCGAGCACGACCGAGCAGGACCGGCTCCTGGCCGACCTGCGGGTGTGC
CTGCGGGAATCGGCGAGTCAGCAGGACTCCGAACGGACGCCGGACAGCTGCCGAAACCTC
CAGCAGGCCCGGCCGGCGGTGGCCGAGGCCACGGCGCGGGCCTGGCGGACGGCCCACACC
GAGAACTTCAGCACCGCGATGGTCCGCACGCTCTGGGTGGTGATCGCACTGCTGGCGGTC
TCCTTCGCGCTGGCCTTCCGGCTGCCGCCCAAGCCGCGTGAGGAAGAGGGCTTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011701 Major facilitator superfamily (Family)
 [52-449]  2.1e-48 PF07690
PF07690   MFS_1
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [1-576]  7.90003079443025e-70 SSF103473
SSF103473   MFS_gen_substrate_transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [43-573]  PS50850
PS50850   MFS
SignalP No significant hit
TMHMM
 [76-98]  Transmembrane (o-i) [110-129]  Transmembrane (i-o) [133-155]  Transmembrane (o-i) [167-189]  Transmembrane (i-o) [199-221]  Transmembrane (o-i) [234-253]  Transmembrane (i-o) [258-280]  Transmembrane (o-i) [303-325]  Transmembrane (i-o) [340-362]  Transmembrane (o-i) [369-388]  Transmembrane (i-o) [401-423]  Transmembrane (o-i) [444-466]  Transmembrane (i-o) [546-568]  Transmembrane (o-i)
Transmembrane 13