close all open/close all

CDS information : Actino_00150


close this sectionLocation

Organism
StrainA3(2) (=NBRC 15146)
Entry nameActinorhodin
Contig
Start / Stop / Direction13,889 / 16,024 / + [in whole cluster]
2,819 / 4,954 / + [in contig]
Location13889..16024 [in whole cluster]
2819..4954 [in contig]
TypeCDS
Length2,136 bp (711 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)
GeneactII-ORF3
actB
Gene (GenBank)actII
EC number
Keyword
Note
Note (GenBank)
  • ORF3
Reference
ACC
PmId
[1716725] Transcriptional organization and regulation of an antibiotic export complex in the producing Streptomyces culture. (Mol Gen Genet. , 1991)
[1878971] The act cluster contains regulatory and antibiotic export genes, direct targets for translational control by the bldA tRNA gene of Streptomyces. (Cell. , 1991)
[8636024] Production of actinorhodin-related "blue pigments" by Streptomyces coelicolor A3(2). (J Bacteriol. , 1996)
[23073761] A two-step mechanism for the activation of actinorhodin export and resistance in Streptomyces coelicolor. (MBio. , 2012)

close this sectionSequence

selected fasta
>hypothetical protein
MTRTLLSWPGGRRLKWLVLAAWIGLLIVLQPLAGKLGDVESNDAAAWLPGNAESTEVLEL
SEKFQPADTSPTVIVYDRPSGITAADEAKARADATHFADGTGVVGEPYGPVRSDDGKALR
TVVNVHLGKDGWEGLNAAAKDMRAIARPSAPDGLGVHVTGPTGYAADSAESFSSADFKLT
LVTLLIVVTILVVTYRSPLLWLLPMISAGMSLVISQAIVYLLAKNAGLTVNAQTAMILTV
LVLGAATDYALLLVARYREELRRHEDRHEAMAVALRRAGPAIVASAATVAVSMLVLLLAA
LNSTKGLGPVCAVGVLVGLLSMMTLLPALLVIFGRWVFWPARPKHGTEPDVTRGLWSRIA
RLVSGRPRAVWVTTSLLLGAVATLAVTLNADGLQQKDGFKTKPESVVGEEILTRHFPAGS
GEPMVVIAKGASADQVHAALETVPGVIEVAPPQVKDGLAYVEATLGAGADSPAAMRSVTA
ARETLARLDGAQARVGGSSAVVHDMREASSRDRGLIIPVILAVVFCILALLLRALVAPLL
LIASVVLSFFTALGLAALFFNHVFDFAGADSAFPLWVFVFLVALGVDYNIFLVTRIKEES
DRLGTRQGALKGLTSTGGVITAAGLVLAGTFAALATLPLVFIAELGFTVAVGVLLDTMIV
RSVLVTALTLDVGRWMWWPHPLARREDPSEDPAVSGMPDSIDSEASTTASR
selected fasta
>hypothetical protein
ATGACACGCACACTGCTGTCCTGGCCCGGCGGACGCCGGCTCAAGTGGCTGGTGCTCGCG
GCCTGGATCGGTCTGCTGATCGTGCTCCAGCCGCTGGCAGGGAAGCTCGGCGACGTCGAG
TCCAACGACGCCGCCGCCTGGCTCCCCGGCAATGCGGAGTCGACCGAAGTGCTCGAGCTG
TCCGAGAAGTTCCAGCCGGCCGACACCAGCCCGACCGTGATCGTCTACGACCGCCCGTCC
GGGATCACGGCCGCCGACGAGGCGAAGGCGCGGGCCGACGCCACGCACTTCGCGGACGGC
ACCGGTGTGGTGGGCGAGCCCTACGGCCCGGTGCGCTCGGACGACGGCAAGGCCCTGCGC
ACCGTCGTCAACGTCCACCTCGGCAAGGACGGCTGGGAGGGGCTCAACGCGGCCGCGAAG
GACATGCGGGCGATCGCCCGGCCGAGCGCCCCGGACGGTCTCGGCGTCCACGTCACGGGT
CCGACCGGTTACGCCGCCGATTCCGCAGAGTCCTTCAGCAGCGCCGACTTCAAGCTCACC
CTGGTCACCCTCCTCATCGTCGTGACGATCCTCGTCGTCACCTATCGCAGTCCCTTGCTC
TGGCTGCTGCCGATGATCTCCGCGGGCATGTCCCTGGTCATCTCGCAGGCCATCGTCTAC
CTGCTGGCCAAGAACGCGGGACTCACGGTCAACGCCCAGACGGCGATGATCCTCACGGTC
CTGGTGCTCGGCGCGGCCACCGACTACGCGCTGTTGCTCGTCGCCCGCTACCGCGAGGAG
CTGCGGCGGCACGAGGACCGGCACGAGGCCATGGCCGTGGCGCTGCGCCGGGCCGGTCCC
GCCATCGTGGCCAGCGCCGCCACCGTCGCCGTCAGCATGCTCGTCCTGCTGCTGGCCGCT
CTGAACTCCACCAAGGGTCTCGGCCCGGTCTGCGCCGTCGGCGTGCTGGTCGGCCTGCTG
TCGATGATGACGTTGCTGCCCGCCCTGCTGGTGATCTTCGGACGCTGGGTCTTCTGGCCG
GCCCGGCCGAAGCACGGTACGGAGCCCGACGTCACCCGGGGTCTGTGGTCGCGGATCGCC
CGGCTGGTGTCCGGCCGTCCGCGTGCCGTCTGGGTCACCACCAGCCTGCTGCTGGGGGCG
GTGGCCACGCTGGCCGTCACCCTGAACGCCGACGGCCTCCAGCAGAAGGACGGTTTCAAG
ACCAAGCCGGAGTCGGTGGTGGGCGAGGAGATCCTGACCCGGCACTTCCCGGCCGGCTCC
GGTGAACCCATGGTCGTCATCGCCAAGGGCGCCTCGGCGGACCAGGTGCACGCAGCTCTG
GAGACCGTGCCCGGCGTCATCGAGGTCGCACCACCACAGGTGAAGGACGGCCTCGCCTAT
GTCGAGGCGACGCTCGGCGCCGGGGCGGACTCGCCGGCGGCCATGCGTTCGGTCACCGCG
GCCCGCGAGACACTCGCCCGGCTGGACGGTGCGCAGGCACGGGTGGGCGGCAGCAGCGCC
GTCGTGCACGACATGCGGGAGGCGTCCAGCCGCGACCGCGGTCTGATCATTCCGGTGATC
CTCGCCGTGGTGTTCTGCATCCTCGCGCTGCTGCTGCGAGCACTGGTGGCGCCGCTGCTG
CTGATCGCGAGCGTGGTGCTGTCCTTCTTCACCGCGCTCGGCCTCGCCGCCCTCTTCTTC
AACCACGTCTTCGACTTCGCGGGAGCCGATTCGGCCTTCCCCCTGTGGGTCTTCGTCTTC
CTGGTCGCCCTGGGCGTCGACTACAACATCTTCCTCGTCACCCGGATCAAGGAGGAGAGC
GACCGGCTCGGCACCCGGCAGGGCGCGCTCAAGGGCCTCACCTCGACCGGTGGCGTGATC
ACCGCGGCCGGGCTGGTGCTGGCCGGGACCTTCGCCGCGCTGGCCACGCTGCCGCTGGTC
TTCATCGCCGAGCTCGGATTCACGGTCGCGGTGGGCGTCCTGCTCGACACCATGATCGTG
CGATCGGTCCTGGTCACCGCGCTCACTCTCGATGTCGGCCGGTGGATGTGGTGGCCGCAC
CCGCTCGCCCGGCGCGAGGACCCTTCCGAGGACCCAGCCGTATCAGGAATGCCAGATTCT
ATTGATTCGGAAGCCTCGACCACTGCCTCTCGGTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000731 Sterol-sensing domain (Domain)
 [200-332]  PS50156 [542-670]  PS50156
PS50156   SSD
IPR004869 Membrane transport protein, MMPL type (Domain)
 [47-369]  2.39999999999997e-83 PF03176 [430-681]  2.19999999999997e-61 PF03176
PF03176   MMPL
SignalP
 [1-33]  0.787 Signal
Bacteria, Gram-negative   
 [1-34]  0.883 Signal
Eukaryota   
 [1-41]  0.699 Signal
Bacteria, Gram-positive   
TMHMM
 [16-33]  Transmembrane (i-o) [171-193]  Transmembrane (o-i) [198-220]  Transmembrane (i-o) [235-257]  Transmembrane (o-i) [278-300]  Transmembrane (i-o) [315-337]  Transmembrane (o-i) [368-390]  Transmembrane (i-o) [515-532]  Transmembrane (o-i) [539-561]  Transmembrane (i-o) [571-593]  Transmembrane (o-i) [613-635]  Transmembrane (i-o) [645-667]  Transmembrane (o-i)
Transmembrane 12