close all open/close all

CDS information : Actino_00160


close this sectionLocation

Organism
StrainA3(2) (=NBRC 15146)
Entry nameActinorhodin
Contig
Start / Stop / Direction16,174 / 16,941 / + [in whole cluster]
5,104 / 5,871 / + [in contig]
Location16174..16941 [in whole cluster]
5104..5871 [in contig]
TypeCDS
Length768 bp (255 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Producttranscriptional activator
Product (GenBank)
GeneactII-ORF4
Gene (GenBank)actII
EC number
Keyword
  • SARP family
Note
Note (GenBank)
  • ORF4
Reference
ACC
PmId
[1878971] The act cluster contains regulatory and antibiotic export genes, direct targets for translational control by the bldA tRNA gene of Streptomyces. (Cell. , 1991)
[7683365] Stationary-phase production of the antibiotic actinorhodin in Streptomyces coelicolor A3(2) is transcriptionally regulated. (Mol Microbiol. , 1993)
[16164554] Transcriptional activation of the pathway-specific regulator of the actinorhodin biosynthetic genes in Streptomyces coelicolor. (Mol Microbiol. , 2005)

close this sectionSequence

selected fasta
>transcriptional activator
MRFNLLGRVHVITDAGCVIPLKSSKATQLLVLLLLRRHEVVGSGVLIEELWADHPPRSAM
TTLQTYVYHTRRLLGEHRVTSDDRELVLTQPPGYFALIDEDELDVAVAERLIRTGGRLLE
ENRLEEALASLDAGLDLWRGPALSTVPCGRVLESNIAHLEELRLFGMQLRIDANWRLGRI
GPMIPELRSLVISHPLNETLHAKLMGALCQMGRRAEALESYRNLRRILSDELGVDPTPEI
QRMHMEILNGEKVLV
selected fasta
>transcriptional activator
ATGAGATTCAACTTATTGGGACGTGTCCATGTAATCACCGATGCGGGATGTGTAATTCCG
CTTAAATCCTCGAAGGCGACCCAGCTCCTGGTGCTGCTGCTCCTCAGGCGGCACGAGGTG
GTGGGATCGGGGGTGCTCATCGAGGAGTTGTGGGCGGACCACCCGCCCCGCAGCGCCATG
ACGACGCTGCAGACGTACGTGTACCACACCCGCCGGCTGCTGGGGGAGCACCGGGTGACG
AGCGACGACCGGGAATTGGTCCTGACCCAGCCGCCCGGCTACTTCGCCCTGATCGACGAG
GACGAACTCGACGTCGCGGTCGCCGAGCGTCTGATCCGCACCGGCGGCCGGCTGCTCGAG
GAGAACCGGCTCGAGGAGGCGCTCGCCTCGTTGGACGCGGGACTGGATCTCTGGCGAGGC
CCGGCGCTGTCCACCGTACCGTGCGGCCGGGTGCTCGAAAGCAATATCGCGCACCTGGAA
GAGCTGCGGCTTTTTGGAATGCAGCTCCGTATCGACGCGAATTGGCGGCTGGGCAGAATA
GGGCCGATGATTCCGGAACTCCGGTCCCTGGTAATTTCGCATCCGCTGAACGAGACCCTG
CACGCCAAACTGATGGGCGCGCTCTGTCAGATGGGCAGGCGCGCCGAGGCGCTGGAATCG
TATCGGAATCTCCGGCGGATACTGTCCGACGAACTGGGGGTGGATCCGACGCCGGAAATC
CAGCGTATGCACATGGAAATTCTCAACGGTGAGAAGGTGCTCGTGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001867 Signal transduction response regulator, C-terminal (Domain)
 [16-88]  6.9e-06 SM00862
SM00862   Transcriptional regulatory protein, C ter
 [23-94]  3.4e-12 PF00486
PF00486   Trans_reg_C
IPR005158 Bacterial transcriptional activator domain (Domain)
 [103-248]  2.3e-51 SM01043
SM01043   Bacterial transcriptional activator domai
 [103-248]  9.4e-48 PF03704
PF03704   BTAD
IPR011990 Tetratricopeptide-like helical (Domain)
 [186-226]  0.00055 G3DSA:1.25.40.10
G3DSA:1.25.40.10   no description
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [23-79]  0.00025 G3DSA:1.10.10.10
G3DSA:1.10.10.10   no description
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [1-96]  6.4e-10 SSF46894
SSF46894   C-terminal effector domain of the bipartite response regulators
SignalP No significant hit
TMHMM No significant hit