close all open/close all

CDS information : Actino_00170


close this sectionLocation

Organism
StrainA3(2) (=NBRC 15146)
Entry nameActinorhodin
Contig
Start / Stop / Direction17,080 / 17,865 / + [in whole cluster]
110 / 895 / + [in contig]
Location17080..17865 [in whole cluster]
110..895 [in contig]
TypeCDS
Length786 bp (261 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productpolyketide C-9 ketoreductase
Product (GenBank)
GeneactIII
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • actIII protein
Reference
ACC
PmId
[2469622] Nucleotide sequence, transcription and deduced function of a gene involved in polyketide antibiotic synthesis in Streptomyces coelicolor. (Gene. , 1988)
[2394677] Biosynthesis of anthraquinones by interspecies cloning of actinorhodin biosynthesis genes in streptomycetes: clarification of actinorhodin gene functions. (J Bacteriol. , 1990)
[15458634] The crystal structure of the actIII actinorhodin polyketide reductase: proposed mechanism for ACP and polyketide binding. (Structure. , 2004)
[18205400] Inhibition kinetics and emodin cocrystal structure of a type II polyketide ketoreductase. (Biochemistry. , 2008)
[18691223] Localization of the ActIII actinorhodin polyketide ketoreductase to the cell wall. (FEMS Microbiol Lett. , 2008)
[21506596] Structural and biochemical analyses of regio- and stereospecificities observed in a type II polyketide ketoreductase. (Biochemistry. , 2011)
[24035284] The determinants of activity and specificity in actinorhodin type II polyketide ketoreductase. (Chem Biol. , 2013)

close this sectionSequence

selected fasta
>polyketide C-9 ketoreductase
MATQDSEVALVTGATSGIGLEIARRLGKEGLRVFVCARGEEGLRTTLKELREAGVEADGR
TCDVRSVPEIEALVAAVVERYGPVDVLVNNAGRPGGGATAELADELWLDVVETNLTGVFR
VTKQVLKAGGMLERGTGRIVNIASTGGKQGVVHAAPYSASKHGVVGFTKALGLELARTGI
TVNAVCPGFVETPMAASVREHYSDIWEVSTEEAFDRITARVPIGRYVQPSEVAEMVAYLI
GPGAAAVTAQALNVCGGLGNY
selected fasta
>polyketide C-9 ketoreductase
ATGGCCACGCAGGACTCCGAAGTCGCACTGGTGACGGGTGCGACCAGCGGAATCGGGCTG
GAGATCGCCCGCAGGCTCGGTAAGGAGGGGTTGCGCGTGTTCGTCTGCGCGCGCGGCGAA
GAAGGACTGCGGACGACGCTGAAGGAGTTGCGGGAGGCGGGCGTGGAGGCGGACGGGCGG
ACCTGCGACGTCCGCTCGGTCCCGGAGATCGAGGCTCTCGTGGCGGCGGTGGTCGAGCGT
TACGGTCCGGTCGACGTGCTGGTGAACAACGCGGGCCGGCCCGGCGGCGGCGCCACGGCC
GAACTCGCCGACGAACTCTGGCTCGATGTCGTGGAGACCAACCTCACCGGCGTGTTCCGG
GTGACCAAACAGGTCCTCAAGGCGGGCGGCATGCTCGAACGGGGCACGGGCCGAATCGTC
AACATCGCCTCGACCGGCGGAAAGCAGGGTGTGGTGCACGCCGCGCCCTACTCCGCCTCG
AAGCACGGCGTGGTCGGCTTCACCAAGGCGCTCGGTCTCGAACTGGCGAGGACCGGCATC
ACGGTGAACGCCGTCTGCCCCGGATTCGTCGAGACGCCGATGGCCGCGTCCGTGCGCGAG
CACTACTCGGACATCTGGGAGGTGTCGACCGAGGAGGCCTTCGACCGGATCACCGCGCGC
GTGCCGATCGGCCGGTACGTGCAGCCGTCCGAGGTGGCGGAGATGGTGGCGTACCTGATC
GGGCCCGGTGCGGCCGCGGTCACCGCGCAGGCGCTGAACGTCTGCGGCGGGCTGGGGAAC
TACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [82-93]  1.1e-14 PR00080 [137-145]  1.1e-14 PR00080 [157-176]  1.1e-14 PR00080
PR00080   SDRFAMILY
 [8-175]  5.6e-38 PF00106
PF00106   adh_short
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [8-25]  1e-46 PR00081 [82-93]  1e-46 PR00081 [131-147]  1e-46 PR00081 [157-176]  1e-46 PR00081 [178-195]  1e-46 PR00081 [222-242]  1e-46 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [5-258]  9e-79 G3DSA:3.40.50.720
G3DSA:3.40.50.720   no description
IPR020904 Short-chain dehydrogenase/reductase, conserved site (Conserved_site)
 [144-172]  PS00061
PS00061   ADH_SHORT
SignalP No significant hit
TMHMM No significant hit