close all open/close all

CDS information : Actino_00180


close this sectionLocation

Organism
StrainA3(2) (=NBRC 15146)
Entry nameActinorhodin
Contig
Start / Stop / Direction18,112 / 19,386 / + [in whole cluster]
107 / 1,381 / + [in contig]
Location18112..19386 [in whole cluster]
107..1381 [in contig]
TypeCDS
Length1,275 bp (424 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase beta-ketoacyl synthase subunit
Product (GenBank)Beta-Ketoacyl synthase/Acyl transferase
GeneactI-ORF1
Gene (GenBank)actIORF1
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
Reference
ACC
PmId
[1527048] Nucleotide sequence and deduced functions of a set of cotranscribed genes of Streptomyces coelicolor A3(2) including the polyketide synthase for the antibiotic actinorhodin. (J Biol Chem. , 1992)
[10519556] A chain initiation factor common to both modular and aromatic polyketide synthases. (Nature. , 1999)
[10684659] Mechanistic analysis of a type II polyketide synthase. Role of conserved residues in the beta-ketoacyl synthase-chain length factor heterodimer. (Biochemistry. , 2000)
[15286722] An antibiotic factory caught in action. (Nat Struct Mol Biol. , 2004)
[18034463] Dissecting the component reactions catalyzed by the actinorhodin minimal polyketide synthase. (Biochemistry. , 2007)

close this sectionPKS/NRPS Module

KS3..374

close this sectionSequence

selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [Beta-Ketoacyl synthase/Acyl transferase]
MKRRVVITGVGVRAPGGNGTRQFWELLTSGRTATRRISFFDPSPYRSQVAAEADFDPVAE
GFGPRELDRMDRASQFAVACAREAFAASGLDPDTLDPARVGVSLGSAVAAATSLEREYLL
LSDSGRDWEVDAAWLSRHMFDYLVPSVMPAEVAWAVGAEGPVTMVSTGCTSGLDSVGNAV
RAIEEGSADVMFAGAADTPITPIVVACFDAIRATTARNDDPEHASRPFDGTRDGFVLAEG
AAMFVLEDYDSALARGARIHAEISGYATRCNAYHMTGLKADGREMAETIRVALDESRTDA
TDIDYINAHGSGTRQNDRHETAAYKRALGEHARRTPVSSIKSMVGHSLGAIGSLEIAACV
LALEHGVVPPTANLRTSDPECDLDYVPLEARERKLRSVLTVGSGFGGFQSAMVLRDAETA
GAAA
selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [Beta-Ketoacyl synthase/Acyl transferase]
TTGAAGCGCAGAGTCGTCATCACGGGCGTCGGCGTCCGCGCCCCCGGCGGGAACGGCACC
CGGCAGTTCTGGGAACTGCTCACCTCGGGGCGGACGGCGACGCGCCGGATCTCGTTCTTC
GACCCCTCGCCCTACCGTTCACAGGTCGCGGCGGAGGCCGACTTCGACCCGGTCGCCGAG
GGCTTCGGCCCGCGGGAGCTCGACCGGATGGACCGGGCCTCGCAGTTCGCCGTGGCCTGT
GCCCGGGAGGCGTTCGCCGCCAGCGGGCTCGACCCGGACACCCTCGACCCCGCCCGGGTC
GGGGTCAGCCTCGGCAGCGCGGTGGCAGCGGCGACCAGCCTGGAGCGCGAGTATCTGCTG
CTGTCGGACTCCGGCCGTGACTGGGAGGTCGACGCGGCCTGGCTGTCCCGGCACATGTTC
GACTACCTGGTGCCCAGCGTCATGCCGGCCGAGGTCGCCTGGGCGGTCGGCGCCGAGGGC
CCGGTCACGATGGTCTCCACCGGCTGCACCTCGGGCCTGGACTCCGTCGGCAACGCGGTC
CGGGCGATCGAGGAGGGCAGCGCCGACGTGATGTTCGCGGGAGCCGCCGACACCCCGATC
ACCCCGATCGTCGTCGCCTGCTTCGACGCGATCCGCGCCACGACGGCGCGCAACGACGAC
CCGGAGCACGCCTCGCGGCCGTTCGACGGTACGCGGGACGGCTTCGTGCTGGCCGAAGGA
GCCGCGATGTTCGTCCTGGAGGACTACGACAGCGCGCTGGCCCGCGGAGCCCGCATCCAC
GCCGAGATCTCGGGGTACGCGACGCGCTGCAACGCGTACCACATGACGGGCCTGAAGGCC
GACGGCCGCGAGATGGCCGAGACCATCCGGGTCGCCCTCGACGAGTCCCGCACGGACGCG
ACGGACATCGACTACATCAACGCGCACGGCTCCGGCACCCGGCAGAACGACCGCCACGAG
ACAGCGGCGTACAAGCGCGCCCTCGGCGAACACGCCCGGCGCACTCCGGTCAGCTCGATC
AAGTCGATGGTCGGCCACTCGCTGGGCGCGATCGGCTCGCTGGAGATCGCGGCCTGCGTA
CTCGCCCTCGAACACGGCGTGGTGCCCCCGACCGCCAACCTGCGCACCAGCGACCCCGAG
TGCGATCTCGACTACGTTCCGCTGGAGGCCAGGGAGCGGAAGCTGCGGTCCGTACTCACC
GTGGGCAGCGGCTTCGGCGGCTTCCAGAGCGCGATGGTGCTGCGCGACGCCGAGACCGCG
GGGGCGGCCGCATGA
KS3..374
KS7..1122

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [3-248]  1.7e-62 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [260-374]  9.6e-38 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [2-265]  6.2e-64 G3DSA:3.40.47.10 [270-418]  6.2e-51 G3DSA:3.40.47.10
G3DSA:3.40.47.10   no description
IPR016039 Thiolase-like (Domain)
 [2-419]  4.2e-69 SSF53901
SSF53901   Thiolase-like
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [160-176]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [5-419]  2.2e-14 SM00825
SM00825   Beta-ketoacyl synthase
SignalP No significant hit
TMHMM No significant hit