close all open/close all

CDS information : Actino_00190


close this sectionLocation

Organism
StrainA3(2) (=NBRC 15146)
Entry nameActinorhodin
Contig
Start / Stop / Direction19,383 / 20,606 / + [in whole cluster]
1,378 / 2,601 / + [in contig]
Location19383..20606 [in whole cluster]
1378..2601 [in contig]
TypeCDS
Length1,224 bp (407 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase chain length factor subunit
Product (GenBank)
GeneactI-ORF2
Gene (GenBank)actIORF2
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
Reference
ACC
PmId
[1527048] Nucleotide sequence and deduced functions of a set of cotranscribed genes of Streptomyces coelicolor A3(2) including the polyketide synthase for the antibiotic actinorhodin. (J Biol Chem. , 1992)
[10519556] A chain initiation factor common to both modular and aromatic polyketide synthases. (Nature. , 1999)
[10684659] Mechanistic analysis of a type II polyketide synthase. Role of conserved residues in the beta-ketoacyl synthase-chain length factor heterodimer. (Biochemistry. , 2000)
[15286722] An antibiotic factory caught in action. (Nat Struct Mol Biol. , 2004)
[18034463] Dissecting the component reactions catalyzed by the actinorhodin minimal polyketide synthase. (Biochemistry. , 2007)

close this sectionPKS/NRPS Module

CLF2..360

close this sectionSequence

selected fasta
>polyketide synthase chain length factor subunit
MSVLITGVGVVAPNGLGLAPYWSAVLDGRHGLGPVTRFDVSRYPATLAGQIDDFHAPDHI
PGRLLPQTDPSTRLALTAADWALQDAKADPESLTDYDMGVVTANACGGFDFTHREFRKLW
SEGPKSVSVYESFAWFYAVNTGQISIRHGMRGPSSALVAEQAGGLDALGHARRTIRRGTP
LVVSGGVDSALDPWGWVSQIASGRISTATDPDRAYLPFDERAAGYVPGEGGAILVLEDSA
AAEARGRHDAYGELAGCASTFDPAPGSGRPAGLERAIRLALNDAGTGPEDVDVVFADGAG
VPELDAAEARAIGRVFGREGVPVTVPKTTTGRLYSGGGPLDVVTALMSLREGVIAPTAGV
TSVPREYGIDLVLGEPRSTAPRTALVLARGRWGFNSAAVLRRFAPTP
selected fasta
>polyketide synthase chain length factor subunit
ATGAGCGTCCTCATCACCGGAGTCGGCGTCGTCGCACCCAACGGCCTCGGCCTGGCGCCG
TACTGGTCGGCGGTGCTGGACGGCCGCCACGGCCTCGGCCCGGTCACCCGCTTCGACGTG
AGCCGGTACCCGGCGACCCTCGCCGGCCAGATCGACGACTTCCACGCGCCGGACCACATC
CCGGGCCGGTTGCTGCCGCAGACGGACCCCTCCACACGGCTCGCGCTGACCGCCGCGGAC
TGGGCCCTCCAGGACGCGAAGGCGGACCCGGAGTCGCTGACCGACTACGACATGGGCGTG
GTGACCGCCAACGCCTGCGGTGGGTTCGACTTCACCCACCGGGAGTTCCGCAAGCTGTGG
TCCGAGGGCCCCAAGTCGGTCAGCGTGTACGAGTCCTTCGCCTGGTTCTACGCGGTGAAC
ACCGGCCAGATCTCCATCCGGCACGGTATGCGCGGTCCGAGCAGTGCCCTGGTCGCCGAG
CAGGCCGGGGGCCTGGACGCCCTGGGCCACGCCCGCCGTACGATCCGCCGCGGCACGCCG
CTGGTGGTCTCCGGCGGGGTGGACTCGGCACTCGACCCGTGGGGCTGGGTCTCGCAGATC
GCCAGTGGCCGGATCAGCACGGCCACCGATCCGGACCGGGCGTATCTGCCCTTCGACGAG
CGGGCGGCCGGCTACGTTCCGGGCGAGGGCGGGGCCATCCTCGTCCTGGAGGACAGCGCC
GCGGCCGAGGCCCGCGGCCGGCACGACGCGTACGGCGAACTCGCCGGCTGCGCCTCCACC
TTCGACCCCGCCCCCGGATCCGGACGGCCCGCGGGCCTGGAACGCGCGATCCGGCTGGCG
CTGAACGACGCCGGGACCGGTCCCGAGGACGTCGACGTCGTGTTCGCCGACGGCGCGGGC
GTGCCCGAGCTGGACGCCGCCGAGGCCCGGGCGATCGGCCGGGTGTTCGGCCGCGAAGGG
GTGCCCGTCACCGTCCCCAAGACGACGACGGGCCGCCTCTACTCCGGCGGCGGCCCGCTC
GACGTGGTCACCGCCCTGATGTCCCTGCGCGAAGGGGTGATCGCGCCGACCGCGGGCGTG
ACGTCCGTACCCCGGGAGTACGGCATCGACCTGGTGCTCGGCGAACCCCGCAGCACGGCC
CCGCGCACCGCACTGGTCCTGGCCAGGGGCCGCTGGGGCTTCAACTCGGCGGCGGTCCTG
CGCCGTTTCGCACCGACCCCGTAA
CLF2..360
CLF4..1080

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [2-241]  1.80000000000002e-55 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [251-360]  2.7e-25 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [2-255]  2.50000000000001e-56 G3DSA:3.40.47.10 [268-404]  2.29999999999998e-38 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [2-247]  9.80000272130214e-61 SSF53901 [210-403]  5.50001754266469e-49 SSF53901
SSF53901   Thiolase-like
SignalP
 [1-17]  0.631 Signal
Eukaryota   
TMHMM No significant hit