close all open/close all

CDS information : Actino_00210


close this sectionLocation

Organism
StrainA3(2) (=NBRC 15146)
Entry nameActinorhodin
Contig
Start / Stop / Direction20,888 / 21,838 / + [in whole cluster]
2,883 / 3,833 / + [in contig]
Location20888..21838 [in whole cluster]
2883..3833 [in contig]
TypeCDS
Length951 bp (316 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productcyclase/dehydratase
Product (GenBank)Cyclase/dehydrase
GeneactVII
Gene (GenBank)actIORF4
EC number
Keyword
  • 1st ring
Note
Note (GenBank)
Reference
ACC
PmId
[1527048] Nucleotide sequence and deduced functions of a set of cotranscribed genes of Streptomyces coelicolor A3(2) including the polyketide synthase for the antibiotic actinorhodin. (J Biol Chem. , 1992)
[11851466] Genetic Contributions to Understanding Polyketide Synthases. (Chem Rev. , 1997)

close this sectionSequence

selected fasta
>cyclase/dehydratase [Cyclase/dehydrase]
MSRPGEHRVVHTLRTQAPARRLYELVARVEDWPAVFEPTVHVQVLERGPGTERFRIWARV
GGRVKTWTSRRTLDPDTLRVTFRQELTQPPIASMGGSWEFRGDGDGTEVVLTHDFAAVDE
AALPGLREALDANSGKELAALVALAERRQPPEELVFTFEDTLRVPSGDDAYAFIERSDLW
QERLPHVRKVTLTEEAAGTGPAETRDMTVQDMTMETVTTDGGTHTTRSIRLCVPARSIVY
KQLVPPALLSGHCGAWTFGEDTVTARHTVAIDPARVEEVLGKGATVADARTHLREVLGAN
SRATLRHAAAAAGPAS
selected fasta
>cyclase/dehydratase [Cyclase/dehydrase]
ATGAGCCGGCCGGGAGAACACCGGGTGGTCCACACCCTGAGGACCCAGGCCCCGGCGCGG
CGGCTCTACGAGCTGGTCGCACGCGTCGAAGACTGGCCGGCCGTCTTCGAACCCACCGTG
CACGTACAGGTCCTGGAGCGCGGCCCGGGCACCGAACGCTTCCGGATCTGGGCGCGCGTG
GGCGGCCGGGTGAAGACCTGGACGTCCCGCCGGACGCTGGATCCCGACACCCTGAGGGTG
ACGTTCCGCCAGGAGCTCACCCAGCCGCCCATCGCCTCGATGGGCGGGAGCTGGGAGTTC
CGGGGCGACGGCGACGGCACCGAAGTCGTGCTGACCCACGACTTCGCCGCGGTCGACGAA
GCCGCCCTGCCGGGACTGCGCGAGGCGCTGGACGCGAACAGCGGGAAGGAGCTGGCCGCG
CTGGTCGCGCTGGCGGAGCGCCGGCAGCCGCCCGAGGAGCTGGTCTTCACGTTCGAGGAC
ACGCTCCGGGTGCCGTCCGGGGACGACGCCTACGCCTTCATCGAGCGCAGCGACCTGTGG
CAGGAACGGCTGCCGCACGTGCGGAAGGTGACACTCACCGAGGAGGCGGCGGGTACCGGC
CCCGCCGAGACGCGGGACATGACCGTCCAGGACATGACCATGGAGACGGTGACCACCGAC
GGCGGTACCCACACCACCCGTTCGATCCGGCTCTGCGTCCCCGCGAGGAGCATCGTGTAC
AAGCAGCTCGTCCCGCCCGCCCTGCTCTCCGGGCACTGCGGCGCCTGGACCTTCGGCGAG
GACACGGTCACCGCCCGCCACACCGTGGCGATCGACCCGGCCCGCGTGGAAGAGGTCCTG
GGCAAAGGCGCGACCGTCGCGGACGCCCGTACCCATCTGCGCGAGGTGCTCGGTGCCAAC
AGCCGGGCCACGCTCCGCCACGCGGCGGCCGCCGCCGGGCCGGCGTCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005031 Streptomyces cyclase/dehydrase (Family)
 [16-125]  4.6e-11 PF03364
PF03364   Polyketide_cyc
IPR023393 START-like domain (Domain)
 [9-116]  1e-14 G3DSA:3.30.530.20
G3DSA:3.30.530.20   G3DSA:3.30.530.20
SignalP No significant hit
TMHMM No significant hit