close all open/close all

CDS information : Actino_00220


close this sectionLocation

Organism
StrainA3(2) (=NBRC 15146)
Entry nameActinorhodin
Contig
Start / Stop / Direction21,835 / 22,728 / + [in whole cluster]
3,830 / 4,723 / + [in contig]
Location21835..22728 [in whole cluster]
3830..4723 [in contig]
TypeCDS
Length894 bp (297 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productcyclase/dehydratase
Product (GenBank)Dehydrase
GeneactIV
Gene (GenBank)actIORF5
EC number
Keyword
  • 2nd ring
Note
Note (GenBank)
Reference
ACC
PmId
[1527048] Nucleotide sequence and deduced functions of a set of cotranscribed genes of Streptomyces coelicolor A3(2) including the polyketide synthase for the antibiotic actinorhodin. (J Biol Chem. , 1992)
[11851466] Genetic Contributions to Understanding Polyketide Synthases. (Chem Rev. , 1997)
Conflict
Sequence
E (279..279)
Comment
conflict with Q93IZ0 (A)

close this sectionSequence

selected fasta
>cyclase/dehydratase [Dehydrase]
MTVEVREVAEGVYAYEQAPGGWCVSNAGIVVGGDGALVVDTLSTIPRARRLAEWVDKLAA
GPGRTVVNTHFHGDHAFGNQVFAPGTRIIAHEDMRSAMVTTGLALTGLWPRVDWGEIELR
PPNVTFRDRLTLHVGERQVELICVGPAHTDHDVVVWLPEERVLFAGDVVMSGVTPFALFG
SVAGTLAALDRLAELEPEVVVGGHGPVAGPEVIDANRDYLRWVQRLAADAVDRRLTPLQA
ARRADLGAFAGLLDAERLVANLHRAHEELLGGHVRDAMEIFAELVAYNGGQLPTCLA
selected fasta
>cyclase/dehydratase [Dehydrase]
ATGACGGTCGAGGTCCGTGAGGTCGCCGAGGGTGTCTACGCCTACGAGCAGGCCCCCGGC
GGCTGGTGCGTCAGCAACGCGGGCATCGTGGTGGGCGGCGACGGCGCGCTCGTCGTCGAC
ACGCTGTCGACGATCCCGAGGGCGCGGCGGCTGGCGGAGTGGGTCGACAAGCTCGCCGCG
GGCCCCGGCCGTACCGTGGTCAACACCCACTTCCACGGCGACCACGCCTTCGGCAACCAG
GTCTTCGCGCCGGGGACGCGGATCATCGCGCACGAGGACATGCGGTCCGCCATGGTGACG
ACCGGCCTGGCCCTCACCGGGCTCTGGCCGCGGGTCGACTGGGGCGAGATCGAGCTGAGG
CCGCCGAACGTGACCTTCCGCGACCGGTTGACCCTGCACGTCGGCGAGCGACAGGTCGAA
CTGATCTGCGTCGGCCCCGCGCACACCGATCACGACGTGGTGGTCTGGCTGCCCGAGGAG
CGGGTGCTGTTCGCGGGGGACGTCGTCATGTCGGGCGTCACTCCGTTCGCCCTCTTCGGT
TCGGTGGCCGGCACGCTGGCCGCGCTCGACCGGCTGGCGGAGCTGGAGCCCGAGGTGGTC
GTCGGCGGGCACGGCCCGGTGGCGGGACCCGAGGTGATCGACGCCAACCGGGACTATCTG
CGCTGGGTCCAGCGCCTCGCCGCCGATGCGGTCGACCGCCGGCTGACACCGTTGCAGGCC
GCGCGCCGGGCGGACCTCGGCGCCTTCGCCGGGCTGCTGGACGCGGAGCGCCTCGTCGCG
AACCTGCACCGGGCCCACGAGGAGCTGCTGGGCGGGCACGTGCGTGACGCCATGGAGATC
TTCGCGGAGCTGGTCGCCTACAACGGTGGGCAGCTGCCCACCTGCCTCGCCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001279 Beta-lactamase-like (Domain)
 [21-204]  9.8e-24 PF00753
PF00753   Lactamase_B
 [24-204]  2.1e-31 SM00849
SM00849   Metallo-beta-lactamase superfamily
SignalP No significant hit
TMHMM No significant hit