close all open/close all
Actino_00220 Actino_00220   last last

CDS information : Actino_00230


close this sectionLocation

Organism
StrainA3(2) (=NBRC 15146)
Entry nameActinorhodin
Contig
Start / Stop / Direction22,740 / 23,273 / + [in whole cluster]
4,735 / 5,268 / + [in contig]
Location22740..23273 [in whole cluster]
4735..5268 [in contig]
TypeCDS
Length534 bp (177 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
ProductNADH-dependent FMN reductase
Product (GenBank)Dimerase
GeneactVB
Gene (GenBank)actIORF6
EC number1.5.1.42
Keyword
  • two-component system
  • C-6 quinone formation
  • C-8 hydroxylate
Note
Note (GenBank)
Reference
ACC
PmId
[1527048] Nucleotide sequence and deduced functions of a set of cotranscribed genes of Streptomyces coelicolor A3(2) including the polyketide synthase for the antibiotic actinorhodin. (J Biol Chem. , 1992)
[7615536] Identification of a flavin:NADH oxidoreductase involved in the biosynthesis of actinorhodin. Purification and characterization of the recombinant enzyme. (J Biol Chem. , 1995)
[18245777] Mechanism and regulation of the Two-component FMN-dependent monooxygenase ActVA-ActVB from Streptomyces coelicolor. (J Biol Chem. , 2008)
[19246012] Biosynthesis of actinorhodin and related antibiotics: discovery of alternative routes for quinone formation encoded in the act gene cluster. (Chem Biol. , 2009)
[22086671] Epoxyquinone formation catalyzed by a two-component flavin-dependent monooxygenase involved in biosynthesis of the antibiotic actinorhodin. (Chembiochem. , 2011)

close this sectionSequence

selected fasta
>NADH-dependent FMN reductase [Dimerase]
MAADQGMLRDAMARVPAGVALVTAHDRGGVPHGFTASSFVSVSMEPPLALVCLARTANSF
PVFDSCGEFAVSVLREDHTDLAMRFARKSADKFAGGEFVRTARGATVLDGAVAVVECTVH
ERYPAGDHIILLGEVQSVHVEEKGVPAVYVDRRFAALCSAAGACPSATGRGVPAHAG
selected fasta
>NADH-dependent FMN reductase [Dimerase]
ATGGCAGCCGACCAGGGAATGCTCCGGGACGCCATGGCCCGGGTGCCGGCCGGGGTGGCG
CTCGTCACCGCCCATGACCGCGGGGGAGTCCCGCACGGTTTCACCGCCAGTTCGTTCGTG
TCCGTCTCGATGGAGCCGCCACTGGCACTGGTCTGCCTGGCTCGTACGGCCAACTCCTTC
CCGGTGTTCGACAGTTGCGGCGAGTTCGCGGTGAGCGTGCTGCGCGAGGACCACACGGAC
CTGGCCATGCGCTTCGCGCGCAAGTCCGCGGACAAGTTCGCGGGCGGGGAGTTCGTCCGT
ACCGCGCGGGGAGCGACCGTGCTCGACGGAGCGGTCGCGGTCGTCGAGTGCACGGTCCAC
GAGCGCTACCCGGCGGGCGACCACATCATCCTGCTCGGCGAGGTCCAGTCCGTGCACGTC
GAGGAGAAGGGCGTACCGGCGGTCTACGTGGACCGCCGGTTCGCCGCCCTGTGCTCGGCG
GCGGGTGCCTGCCCGTCCGCCACCGGGCGGGGCGTGCCCGCGCATGCCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002563 Flavin reductase-like, FMN-binding (Domain)
 [12-156]  1.8e-56 SM00903
SM00903   Flavin reductase like domain
 [12-157]  3.4e-37 PF01613
PF01613   Flavin_Reduct
IPR009002 FMN-binding split barrel-related (Domain)
 [7-157]  9.9e-48 SSF50475
SSF50475   FMN-binding split barrel
IPR012349 FMN-binding split barrel (Domain)
 [4-156]  1e-54 G3DSA:2.30.110.10
G3DSA:2.30.110.10   no description
SignalP No significant hit
TMHMM No significant hit
Actino_00220 Actino_00220   last last