close all open/close all

CDS information : Adria_00010


close this sectionLocation

Organism
StrainATCC 29050 (=NBRC 100596)
Entry nameDoxorubicin
Contig
Start / Stop / Direction18,335 / 17,088 / - [in whole cluster]
1,330 / 83 / - [in contig]
Locationcomplement(17088..18335) [in whole cluster]
complement(83..1330) [in contig]
TypeCDS
Length1,248 bp (415 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productcytochrome P450
Product (GenBank)daunorubicin C-14 hydroxylase
Gene
Gene (GenBank)doxA
EC number
Keyword
  • C-13 hydroxylate
  • C-13 OH group oxidation
  • C-14 hydroxylate
Note
Note (GenBank)
  • CYP450 hydroxylase
Reference
ACC
PmId
[9864344] Doxorubicin overproduction in Streptomyces peucetius: cloning and characterization of the dnrU ketoreductase and dnrV genes and the doxA cytochrome P-450 hydroxylase gene. (J Bacteriol. , 1999)
Related Reference
ACC
Q59971
NITE
Dauno_00210
PmId
[8655530] Isolation and characterization of a gene from Streptomyces sp. strain C5 that confers the ability to convert daunomycin to doxorubicin on Streptomyces lividans TK24. (J Bacteriol. , 1996)
[9098063] In vivo and in vitro bioconversion of epsilon-rhodomycinone glycoside to doxorubicin: functions of DauP, DauK, and DoxA. (J Bacteriol. , 1997)
[9864343] Purification, properties, and characterization of recombinant Streptomyces sp. strain C5 DoxA, a cytochrome P-450 catalyzing multiple steps in doxorubicin biosynthesis. (J Bacteriol. , 1999)
ACC
Q93MI2
PmId
[26334717] Understanding of real alternative redox partner of Streptomyces peucetius DoxA: Prediction and validation using in silico and in vitro analyses. (Arch Biochem Biophys. , 2015)

close this sectionSequence

selected fasta
>cytochrome P450 [daunorubicin C-14 hydroxylase]
MAVDPFACPMMTMQRKPEVHDAFREAGPVVEVNAPAGGPAWVITDDALAREVLADPRFVK
DPDLAPAAWRGVDDGLDIPVPELRPFTLIAVDGEAHRRLRRIHAPAFNPRRLAERTDRIA
AIAGRLLTELADASGRSGKPAELIGGFAYHFPLLVICELLGVPVTDPAMAREAVSVLKAL
GLGGPQSGGGDGTDPAGGVPDTSALESLLLEAVHSARRNDTPTMTRVLYERAQAEFGSVS
DDQLVYMITGLIFAGHDTTGSFLGFLLAEVLAGRLAADADEDAVSRFVEEALRYHPPVPY
TLWRFAATEVTIGGVRLPRGAPVLVDIEGTNTDGRHHDAPHAFHPDRPSWRRLTFGDGPH
YCIGEQLAQLESRTMIGVLRSRFPEARLAVPYDELRWCRKGAQTARLTELPVWLR
selected fasta
>cytochrome P450 [daunorubicin C-14 hydroxylase]
GTGGCCGTCGACCCGTTCGCGTGTCCCATGATGACCATGCAGCGCAAGCCCGAGGTGCAC
GACGCCTTCCGGGAGGCGGGCCCGGTCGTCGAGGTGAACGCCCCCGCGGGCGGACCCGCC
TGGGTCATCACCGATGACGCCCTCGCCCGCGAGGTGCTGGCCGATCCCCGGTTCGTGAAG
GACCCCGACCTCGCCCCCGCCGCCTGGCGGGGGGTGGACGACGGTCTCGACATCCCCGTT
CCGGAGCTGCGTCCGTTCACGCTCATCGCCGTGGACGGCGAGGCCCACCGGCGCCTGCGC
CGCATCCACGCACCTGCGTTCAACCCGCGCCGGCTGGCCGAGCGGACGGATCGCATCGCC
GCGATCGCCGGCCGGCTGCTCACCGAACTCGCCGACGCCTCCGGCCGGTCGGGCAAACCG
GCCGAGCTGATCGGCGGCTTCGCGTACCACTTCCCGCTGTTGGTCATCTGCGAGCTGCTC
GGTGTGCCGGTCACCGATCCGGCGATGGCCCGCGAGGCCGTCAGCGTTCTCAAGGCACTC
GGCCTCGGCGGCCCGCAGAGCGGCGGGGGTGACGGCACGGACCCTGCCGGGGGCGTGCCG
GACACCTCGGCCCTGGAGAGCCTGCTCCTCGAAGCCGTGCACTCAGCCCGGCGGAACGAC
ACCCCGACCATGACCCGCGTGCTGTACGAGCGCGCGCAGGCCGAGTTCGGCTCGGTCTCC
GACGACCAGCTCGTCTACATGATCACCGGGCTCATCTTCGCCGGCCACGACACCACCGGC
TCCTTCCTGGGCTTCCTGCTCGCGGAGGTCCTGGCGGGCCGCCTCGCGGCGGATGCCGAC
GAGGACGCCGTCTCCCGGTTCGTGGAGGAGGCGCTGCGCTACCACCCGCCGGTGCCCTAC
ACGTTGTGGAGGTTCGCTGCCACGGAGGTGACCATCGGCGGCGTCCGGCTGCCCCGCGGA
GCGCCGGTGCTGGTGGACATCGAGGGCACCAACACCGACGGCCGCCATCACGACGCCCCG
CACGCCTTCCACCCGGACCGTCCCTCGTGGCGGCGGCTCACCTTCGGCGACGGGCCGCAC
TACTGCATCGGGGAGCAGCTCGCCCAGCTGGAGTCGCGCACGATGATCGGCGTACTGCGC
AGCAGGTTCCCCGAGGCCCGACTGGCCGTGCCGTACGACGAGTTGCGGTGGTGCCGGAAG
GGGGCCCAGACGGCGCGGCTCACCGAACTGCCCGTCTGGCTGCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [19-414]  2.19999900980707e-69 SSF48264
SSF48264   Cytochrome_P450
 [254-271]  4.89999951782359e-08 PR00385 [286-297]  4.89999951782359e-08 PR00385 [353-362]  4.89999951782359e-08 PR00385 [362-373]  4.89999951782359e-08 PR00385
PR00385   P450
 [286-382]  7.29999999999998e-17 PF00067
PF00067   p450
 [18-413]  1.39999999999997e-75 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
IPR002397 Cytochrome P450, B-class (Family)
 [91-102]  1e-27 PR00359 [142-158]  1e-27 PR00359 [159-174]  1e-27 PR00359 [286-297]  1e-27 PR00359 [304-331]  1e-27 PR00359 [353-362]  1e-27 PR00359 [362-373]  1e-27 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [355-364]  PS00086
PS00086   CYTOCHROME_P450
SignalP
 [1-22]  0.14 Signal
Bacteria, Gram-positive   
TMHMM No significant hit